Advanced Search (OLGA)

Gene: N6amt1 (N-6 adenine-specific DNA methyltransferase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

N6amt1

Name:

N-6 adenine-specific DNA methyltransferase 1

RGD ID:

1311843

Description:

Predicted to enable S-adenosyl-L-methionine binding activity and S-adenosylmethionine-dependent methyltransferase activity. Predicted to be involved in several processes, including arsonoacetate metabolic process; epigenetic regulation of gene expression; and peptidyl-glutamine methylation. Predicted to act upstream of or within positive regulation of cell growth. Predicted to be located in nucleus. Predicted to be part of eRF1 methyltransferase complex. Orthologous to human N6AMT1 (N-6 adenine-specific DNA methyltransferase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

HemK methyltransferase family member 2; Hemk2; LOC288309; methyltransferase N6AMT1; N(6)-adenine-specific DNA methyltransferase 1; N-6 adenine-specific DNA methyltransferase 1 (putative); RGD1311843; similar to N6-DNA-methyltransferase isoform 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	40,071,017 - 40,083,463 (+)	NCBI		GRCr8
mRatBN7.2	11	26,584,750 - 26,597,790 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	26,584,724 - 26,608,248 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	35,282,689 - 35,295,029 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	27,982,937 - 27,995,276 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	27,171,867 - 27,184,209 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	27,004,335 - 27,016,690 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	27,004,320 - 27,016,941 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	30,629,574 - 30,641,929 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	27,107,106 - 27,119,552 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	27,107,109 - 27,119,546 (+)	NCBI
Celera	11	26,337,923 - 26,356,638 (+)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
N6amt1	Rat	17alpha-ethynylestradiol	affects expression	ISO	N6amt1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of HEMK2 mRNA	CTD	PMID:17555576
N6amt1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	N6amt1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of HEMK2 mRNA	CTD	PMID:15328365
N6amt1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of HEMK2 mRNA	CTD	PMID:33387578
N6amt1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	N6amt1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of HEMK2 mRNA	CTD	PMID:21570461
N6amt1	Rat	2,3,7,8-Tetrachlorodibenzofuran	increases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
N6amt1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	N6amt1 (Mus musculus)	6480464	bisphenol S results in increased expression of HEMK2 mRNA	CTD	PMID:39298647
N6amt1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of HEMK2 mRNA	CTD	PMID:30047161
N6amt1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of HEMK2 mRNA	CTD	PMID:31881176
N6amt1	Rat	all-trans-retinoic acid	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of HEMK2 mRNA	CTD	PMID:33167477
N6amt1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of HEMK2 mRNA	CTD	PMID:30047161
N6amt1	Rat	aristolochic acid A	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of HEMK2 mRNA	CTD	PMID:33212167
N6amt1	Rat	arsane	decreases response to substance	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein results in decreased susceptibility to Arsenic	CTD	PMID:25997655
N6amt1	Rat	arsane	affects metabolic processing	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein polymorphism affects the metabolism of Arsenic	CTD	PMID:27637898
N6amt1	Rat	arsane	increases methylation	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 gene polymorphism results in increased methylation of Arsenic	CTD	PMID:23665909
N6amt1	Rat	arsane	affects response to substance	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein affects the susceptibility to Arsenic	CTD	PMID:21193388
N6amt1	Rat	arsenic atom	decreases response to substance	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein results in decreased susceptibility to Arsenic	CTD	PMID:25997655
N6amt1	Rat	arsenic atom	affects metabolic processing	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein polymorphism affects the metabolism of Arsenic	CTD	PMID:27637898
N6amt1	Rat	arsenic atom	increases methylation	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 gene polymorphism results in increased methylation of Arsenic	CTD	PMID:23665909
N6amt1	Rat	arsenic atom	affects response to substance	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 protein affects the susceptibility to Arsenic	CTD	PMID:21193388
N6amt1	Rat	benzo[a]pyrene	increases expression	ISO	N6amt1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of HEMK2 mRNA	CTD	PMID:22228805
N6amt1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of HEMK2 mRNA	CTD	PMID:25181051
N6amt1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of HEMK2 gene	CTD	PMID:28505145
N6amt1	Rat	chlorpyrifos	decreases expression	ISO	N6amt1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of HEMK2 mRNA	CTD	PMID:37019170
N6amt1	Rat	cyclosporin A	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of HEMK2 mRNA	CTD	PMID:22147139
N6amt1	Rat	cylindrospermopsin	increases expression	ISO	N6AMT1 (Homo sapiens)	6480464	cylindrospermopsin results in increased expression of HEMK2 mRNA	CTD	PMID:24921660
N6amt1	Rat	dicrotophos	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of HEMK2 mRNA	CTD	PMID:28302478
N6amt1	Rat	dimethylarsinous acid	multiple interactions	ISO	N6AMT1 (Homo sapiens)	6480464	[HEMK2 protein results in increased metabolism of monomethylarsonous acid] which results in increased chemical synthesis of dimethylarsinous acid	CTD	PMID:21193388
N6amt1	Rat	dorsomorphin	multiple interactions	ISO	N6AMT1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HEMK2 mRNA	CTD	PMID:27188386
N6amt1	Rat	doxorubicin	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of HEMK2 mRNA	CTD	PMID:29803840
N6amt1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of HEMK2 mRNA	CTD	PMID:29391264
N6amt1	Rat	ethanol	affects splicing	ISO	N6amt1 (Mus musculus)	6480464	Ethanol affects the splicing of HEMK2 mRNA	CTD	PMID:30319688
N6amt1	Rat	ethyl methanesulfonate	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of HEMK2 mRNA	CTD	PMID:23649840
N6amt1	Rat	fenthion	increases expression	ISO	N6amt1 (Mus musculus)	6480464	Fenthion results in increased expression of HEMK2 mRNA	CTD	PMID:34813904
N6amt1	Rat	folic acid	decreases expression	ISO	N6amt1 (Mus musculus)	6480464	Folic Acid results in decreased expression of HEMK2 mRNA	CTD	PMID:25629700
N6amt1	Rat	formaldehyde	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of HEMK2 mRNA	CTD	PMID:23649840
N6amt1	Rat	fulvestrant	increases methylation	ISO	N6AMT1 (Homo sapiens)	6480464	Fulvestrant results in increased methylation of HEMK2 gene	CTD	PMID:31601247
N6amt1	Rat	ivermectin	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of HEMK2 protein	CTD	PMID:32959892
N6amt1	Rat	maneb	multiple interactions	ISO	N6amt1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of HEMK2 mRNA	CTD	PMID:36117858
N6amt1	Rat	methidathion	increases expression	ISO	N6amt1 (Mus musculus)	6480464	methidathion results in increased expression of HEMK2 mRNA	CTD	PMID:34813904
N6amt1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of HEMK2 mRNA	CTD	PMID:30047161
N6amt1	Rat	methylarsonic acid	increases abundance	ISO	N6AMT1 (Homo sapiens)	6480464	HEMK2 gene polymorphism results in increased abundance of monomethylarsonic acid	CTD	PMID:23665909
N6amt1	Rat	methylmercury chloride	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of HEMK2 mRNA	CTD	PMID:28001369
N6amt1	Rat	nickel atom	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Nickel results in decreased expression of HEMK2 mRNA	CTD	PMID:24768652 and PMID:25583101
N6amt1	Rat	paracetamol	affects expression	ISO	N6amt1 (Mus musculus)	6480464	Acetaminophen affects the expression of HEMK2 mRNA	CTD	PMID:17562736
N6amt1	Rat	paraquat	multiple interactions	ISO	N6amt1 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of HEMK2 mRNA	CTD	PMID:36117858
N6amt1	Rat	perfluorononanoic acid	increases expression	ISO	N6AMT1 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in increased expression of HEMK2 mRNA	CTD	PMID:32588087
N6amt1	Rat	pirinixic acid	increases expression	ISO	N6amt1 (Mus musculus)	6480464	pirinixic acid results in increased expression of HEMK2 mRNA	CTD	PMID:18301758
N6amt1	Rat	quercetin	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Quercetin results in decreased expression of HEMK2 mRNA	CTD	PMID:21632981
N6amt1	Rat	resorcinol	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	resorcinol results in decreased expression of HEMK2 mRNA	CTD	PMID:22623647
N6amt1	Rat	SB 431542	multiple interactions	ISO	N6AMT1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HEMK2 mRNA	CTD	PMID:27188386
N6amt1	Rat	sevoflurane	increases expression	ISO	N6amt1 (Mus musculus)	6480464	Sevoflurane results in increased expression of HEMK2 protein	CTD	PMID:35249202
N6amt1	Rat	sodium arsenite	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of HEMK2 mRNA	CTD	PMID:38568856
N6amt1	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of HEMK2 mRNA	CTD	PMID:19281266
N6amt1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of HEMK2 mRNA	CTD	PMID:30047161
N6amt1	Rat	sunitinib	increases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Sunitinib results in increased expression of HEMK2 mRNA	CTD	PMID:31533062
N6amt1	Rat	thiram	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Thiram results in decreased expression of HEMK2 mRNA	CTD	PMID:38568856
N6amt1	Rat	trichostatin A	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	trichostatin A results in decreased expression of HEMK2 mRNA	CTD	PMID:24935251
N6amt1	Rat	triphenyl phosphate	affects expression	ISO	N6AMT1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of HEMK2 mRNA	CTD	PMID:37042841
N6amt1	Rat	triptonide	decreases expression	ISO	N6amt1 (Mus musculus)	6480464	triptonide results in decreased expression of HEMK2 mRNA	CTD	PMID:33045310
N6amt1	Rat	valproic acid	affects expression	ISO	N6amt1 (Mus musculus)	6480464	Valproic Acid affects the expression of HEMK2 mRNA	CTD	PMID:17963808
N6amt1	Rat	valproic acid	decreases expression	ISO	N6amt1 (Mus musculus)	6480464	Valproic Acid results in decreased expression of HEMK2 mRNA	CTD	PMID:19136453 and PMID:21427059
N6amt1	Rat	valproic acid	decreases expression	ISO	N6AMT1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of HEMK2 mRNA	CTD	PMID:23179753 and PMID:26272509
N6amt1	Rat	valproic acid	multiple interactions	ISO	N6AMT1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HEMK2 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
N6amt1	Rat	arsonoacetate metabolic process	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:25997655	RGD	PMID:25997655
N6amt1	Rat	methylation	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:25997655	RGD	PMID:25997655
N6amt1	Rat	methylation	involved_in	IEA	InterPro:IPR002052	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
N6amt1	Rat	methylation	involved_in	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
N6amt1	Rat	negative regulation of gene expression, epigenetic	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:30017583	RGD	PMID:30017583
N6amt1	Rat	peptidyl-glutamine methylation	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:18539146 and PMID:31636962	RGD	PMID:18539146 and PMID:31636962
N6amt1	Rat	peptidyl-glutamine methylation	involved_in	ISO	N6amt1 (Mus musculus)	1624291	PMID:26797129	RGD	PMID:26797129
N6amt1	Rat	positive regulation of cell growth	acts_upstream_of_or_within	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:18539146	RGD	PMID:18539146
N6amt1	Rat	toxin metabolic process	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:25997655	RGD	PMID:25997655
N6amt1	Rat	transcription initiation-coupled chromatin remodeling	involved_in	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:31061526	RGD	PMID:31061526

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
N6amt1	Rat	eRF1 methyltransferase complex	part_of	IBA	PANTHER:PTN000430810 and SGD:S000002547	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
N6amt1	Rat	nucleus	located_in	ISO	N6amt1 (Mus musculus)	1624291	PMID:19116772	RGD	PMID:19116772
N6amt1	Rat	nucleus	located_in	IEA	UniProtKB:Q6SKR2 and ensembl:ENSMUSP00000061835	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
N6amt1	Rat	protein-containing complex	part_of	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:18539146	RGD	PMID:18539146

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
N6amt1	Rat	arsenite methyltransferase activity	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:25997655	RGD	PMID:25997655
N6amt1	Rat	histone H4K12 methyltransferase activity	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:31061526	RGD	PMID:31061526
N6amt1	Rat	methyltransferase activity	enables	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
N6amt1	Rat	methyltransferase activity	enables	IEA	ARBA:ARBA00028302	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
N6amt1	Rat	methyltransferase activity	enables	IEA	InterPro:IPR002052 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
N6amt1	Rat	nucleic acid binding	enables	IEA	InterPro:IPR002052	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
N6amt1	Rat	protein binding	enables	ISO	N6AMT1 (Homo sapiens)	1624291	UniProtKB:Q9UI30 more ...	RGD	PMID:18539146 more ...
N6amt1	Rat	protein binding	enables	ISO	N6amt1 (Mus musculus)	1624291	UniProtKB:Q9DCG9 and PMID:26797129	RGD	PMID:26797129
N6amt1	Rat	protein methyltransferase activity	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:18539146 and PMID:31632689	RGD	PMID:18539146 and PMID:31632689
N6amt1	Rat	protein methyltransferase activity	enables	IBA	MGI:1915018 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
N6amt1	Rat	protein-glutamine N-methyltransferase activity	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:18539146 more ...	RGD	PMID:18539146 more ...
N6amt1	Rat	protein-glutamine N-methyltransferase activity	enables	IEA	UniProtKB:Q6SKR2 and ensembl:ENSMUSP00000061835	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
N6amt1	Rat	protein-glutamine N-methyltransferase activity	enables	ISO	N6amt1 (Mus musculus)	1624291	PMID:26797129	RGD	PMID:26797129
N6amt1	Rat	S-adenosyl-L-methionine binding	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:31636962	RGD	PMID:31636962
N6amt1	Rat	S-adenosylmethionine-dependent methyltransferase activity	enables	IBA	MGI:1915018 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
N6amt1	Rat	site-specific DNA-methyltransferase (adenine-specific) activity	NOT\|enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:30392959 more ...	RGD	PMID:30392959 more ...
N6amt1	Rat	site-specific DNA-methyltransferase (adenine-specific) activity	enables	ISO	N6AMT1 (Homo sapiens)	1624291	PMID:30017583	RGD	PMID:30017583
N6amt1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18539146	PMID:19116772	PMID:25997655	PMID:26797129	PMID:30017583	PMID:31061526

N6amt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	40,071,017 - 40,083,463 (+)	NCBI		GRCr8
mRatBN7.2	11	26,584,750 - 26,597,790 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	26,584,724 - 26,608,248 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	35,282,689 - 35,295,029 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	27,982,937 - 27,995,276 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	27,171,867 - 27,184,209 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	27,004,335 - 27,016,690 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	27,004,320 - 27,016,941 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	30,629,574 - 30,641,929 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	27,107,106 - 27,119,552 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	27,107,109 - 27,119,546 (+)	NCBI
Celera	11	26,337,923 - 26,356,638 (+)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

N6AMT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	28,575,598 - 28,885,367 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	28,872,191 - 28,885,371 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	30,244,513 - 30,257,689 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	29,166,384 - 29,179,564 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	21	15,427,774 - 15,440,965 (-)	NCBI		Celera
Cytogenetic Map	21	q21.3	NCBI
HuRef	21	15,649,537 - 15,662,924 (-)	NCBI		HuRef
CHM1_1	21	29,806,890 - 29,820,072 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	27,235,374 - 27,248,586 (-)	NCBI		T2T-CHM13v2.0

N6amt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	87,151,073 - 87,165,537 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	87,151,073 - 87,165,630 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	87,354,185 - 87,368,649 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	87,354,185 - 87,368,742 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	87,354,430 - 87,368,894 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	87,243,381 - 87,257,845 (+)	NCBI		MGSCv36	mm8
Celera	16	87,539,465 - 87,553,925 (+)	NCBI		Celera
Cytogenetic Map	16	C3.3	NCBI
cM Map	16	49.52	NCBI

Hemk2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	28,256,649 - 28,276,460 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	28,256,654 - 28,277,514 (+)	NCBI	ChiLan1.0	ChiLan1.0

HEMK2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	24,764,439 - 25,067,011 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	19,621,921 - 19,925,542 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	15,303,430 - 15,316,596 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	28,691,847 - 28,704,745 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	28,694,294 - 28,704,745 (-)	Ensembl	panpan1.1		panPan2

N6AMT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	23,895,558 - 23,934,183 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	23,895,584 - 23,909,940 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	23,888,155 - 23,926,785 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	24,008,039 - 24,046,658 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	24,008,051 - 24,024,515 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	23,959,405 - 23,997,823 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	23,961,154 - 23,999,634 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	24,432,448 - 24,471,137 (+)	NCBI		UU_Cfam_GSD_1.0

Hemk2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	24,368,003 - 24,381,211 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	13,084,595 - 13,099,844 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	13,086,873 - 13,099,814 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

N6AMT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	192,249,246 - 192,265,629 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	192,248,511 - 192,265,923 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	202,558,051 - 202,782,210 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HEMK2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	63,348,897 - 63,363,709 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	63,348,745 - 63,363,090 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	5,935,090 - 5,950,770 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hemk2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	16,908,686 - 16,920,351 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	16,908,683 - 16,922,941 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in N6amt1
62 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	93
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000002182
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	1	35331169	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat

RH129651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	26,603,661 - 26,603,873 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	27,023,087 - 27,023,298	NCBI	Rnor6.0
Rnor_5.0	11	30,648,326 - 30,648,537	UniSTS	Rnor5.0
RGSC_v3.4	11	27,126,017 - 27,126,228	UniSTS	RGSC3.4
Celera	11	26,356,114 - 26,356,325	UniSTS
RH 3.4 Map	11	123.8	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH131197

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	26,592,478 - 26,592,628 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	27,012,064 - 27,012,213	NCBI	Rnor6.0
Rnor_5.0	11	30,637,303 - 30,637,452	UniSTS	Rnor5.0
RGSC_v3.4	11	27,114,835 - 27,114,984	UniSTS	RGSC3.4
Celera	11	26,345,649 - 26,345,798	UniSTS
RH 3.4 Map	11	134.5	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH144456

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	26,604,075 - 26,604,229 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	27,023,501 - 27,023,654	NCBI	Rnor6.0
Rnor_5.0	11	30,648,740 - 30,648,893	UniSTS	Rnor5.0
RGSC_v3.4	11	27,126,431 - 27,126,584	UniSTS	RGSC3.4
Celera	11	26,356,528 - 26,356,681	UniSTS
RH 3.4 Map	11	134.5	UniSTS
Cytogenetic Map	11	q11	UniSTS

BI281238

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	26,604,016 - 26,604,189 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	27,023,442 - 27,023,614	NCBI	Rnor6.0
Rnor_5.0	11	30,648,681 - 30,648,853	UniSTS	Rnor5.0
RGSC_v3.4	11	27,126,372 - 27,126,544	UniSTS	RGSC3.4
Celera	11	26,356,469 - 26,356,641	UniSTS
RH 3.4 Map	11	136.6	UniSTS
Cytogenetic Map	11	q11	UniSTS

BF417415

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	26,596,964 - 26,597,164 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	27,016,458 - 27,016,657	NCBI	Rnor6.0
Rnor_5.0	11	30,641,697 - 30,641,896	UniSTS	Rnor5.0
RGSC_v3.4	11	27,119,320 - 27,119,519	UniSTS	RGSC3.4
RH 3.4 Map	11	136.4	UniSTS
Cytogenetic Map	11	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001191592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002182 ⟹ ENSRNOP00000002182

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	26,584,759 - 26,597,788 (+)	Ensembl
Rnor_6.0 Ensembl	11	27,004,320 - 27,016,941 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095405 ⟹ ENSRNOP00000091834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	26,584,724 - 26,608,248 (+)	Ensembl

RefSeq Acc Id:

NM_001191592 ⟹ NP_001178521

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	40,071,017 - 40,083,463 (+)	NCBI
mRatBN7.2	11	26,584,750 - 26,597,197 (+)	NCBI
Rnor_6.0	11	27,004,335 - 27,016,690 (+)	NCBI
Rnor_5.0	11	30,629,574 - 30,641,929 (+)	NCBI
Celera	11	26,337,923 - 26,356,638 (+)	NCBI

Sequence:

show sequence

AGCGGAAGGGGAAGATGGCGGCGCCGAGTGTCCCCACGCCGTTGTACGGGCACGTGGGTCGTGGAGCCTTCAGCGACGTGTACGAGCCAGCGGAGGACACGTTCCTGTTACTGGACGCGCTCGAGGCG
GCAGCAGCAGAGCTAGCAGGAGTGGAACTATGCCTGGAAGTAGGAGCAGGATCTGGGGTGGTGTCTGCATTCCTAGCCTCCATGATAGGTCCTCAGGCCTTGTACATGTGCACCGATATCAACCCCAA
GGCAGCTGCATGTACCTTGGAAACAGCGCGCTGTAACAGAGTCCACCTTCAGCCAGTAATTACAGATTTGGTCCAAGGCTTGCTGCCCAGATTGAAGGGGAAAGTAGACCTGCTGGTGTTCAACCCCC
CTTACGTCGTGACTCCGCCTGAAGAGGTAGGAAGCCACGGAATAGAAGCAGCTTGGGCTGGTGGAAGAAACGGCCGGGAAGTCATGGACAGGTTCTTCCCACTGGCCTCACAACTTCTCTCCCCAAGA
GGGCTGTTCTACTTAGTTACCATAAAAGAAAACAATCCAGAGGAAATCTTTAAAATAATGAAGACAAGAGGACTACAAGGAACCACGGCACTTTGCAGGCAAGCAGGCCAAGAAACCCTGTCAGTCCT
CAGGTTCAGCAAGTCCTGAAAGCCCCTGAAGTAAATAAACTAGCTACCGGTTGCTGAACACTCAGTAGGTTTGAGACTGATGCCATTCCCTGGCCAAGAAGTTTTACCAAAATTTGTCATTTAAAGAA
AAAGTGGATCCAAGTGGTAGTGGCATAGGCACTCAGGAGACAGAGGCAGGGGGTCTCTAAGTTCAAGGCCTGGTCTACAGAGTGAATTCCAGGACCCTCAGGGCTACACAGAGAAACCAAAACCAAAC
GACGAACGGAAAGGAAAAGAAAAA

hide sequence

RefSeq Acc Id:

XM_039088225 ⟹ XP_038944153

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	40,071,134 - 40,083,247 (+)	NCBI
mRatBN7.2	11	26,584,874 - 26,597,790 (+)	NCBI

RefSeq Acc Id:

XM_039088226 ⟹ XP_038944154

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	40,071,207 - 40,083,247 (+)	NCBI
mRatBN7.2	11	26,584,999 - 26,597,790 (+)	NCBI


Protein RefSeqs	NP_001178521	(Get FASTA)	NCBI Sequence Viewer
	XP_038944153	(Get FASTA)	NCBI Sequence Viewer
	XP_038944154	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM10637	(Get FASTA)	NCBI Sequence Viewer
	EDM10638	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002182
	ENSRNOP00000002182.5
	ENSRNOP00000091834.1

RefSeq Acc Id:

NP_001178521 ⟸ NM_001191592

- UniProtKB:

D4ACA2 (UniProtKB/TrEMBL), A0A8I6AGJ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPSVPTPLYGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVELCLEVGAGSGVVSAFLASMIGPQALYMCTDINPKAAACTLETARCNRVHLQPVITDLVQGLLPRLKGKVDLLVFNPPYVVT
PPEEVGSHGIEAAWAGGRNGREVMDRFFPLASQLLSPRGLFYLVTIKENNPEEIFKIMKTRGLQGTTALCRQAGQETLSVLRFSKS

hide sequence

Ensembl Acc Id:

ENSRNOP00000002182 ⟸ ENSRNOT00000002182

RefSeq Acc Id:	XP_038944153 ⟸ XM_039088225
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038944154 ⟸ XM_039088226
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000091834 ⟸ ENSRNOT00000095405

Protein Domains

Methyltransferase small

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACA2-F1-model_v2	AlphaFold	D4ACA2	1-214	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698019

Promoter ID:

EPDNEW_R8543

Type:

initiation region

Name:

N6amt1_1

Description:

N-6 adenine-specific DNA methyltransferase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	27,004,319 - 27,004,379	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22057	BioCyc
Ensembl Genes	ENSRNOG00000001603	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002182	ENTREZGENE
	ENSRNOT00000002182.8	UniProtKB/TrEMBL
	ENSRNOT00000095405.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.150	UniProtKB/TrEMBL
InterPro	DNA_methylase_N6_adenine_CS	UniProtKB/TrEMBL
	Euk-Arch_PrmC-MTase	UniProtKB/TrEMBL
	HemK_rel_arch	UniProtKB/TrEMBL
	SAM-dependent_MTases-like	UniProtKB/TrEMBL
	Small_mtfrase_dom	UniProtKB/TrEMBL
KEGG Report	rno:288309	UniProtKB/TrEMBL
NCBI Gene	288309	ENTREZGENE
PANTHER	METHYLTRANSFERASE N6AMT1	UniProtKB/TrEMBL
	METHYLTRANSFERASE N6AMT1	UniProtKB/TrEMBL
Pfam	MTS	UniProtKB/TrEMBL
PhenoGen	N6amt1	PhenoGen
PROSITE	N6_MTASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001603	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/TrEMBL
UniProt	A0A8I6AGJ1	ENTREZGENE, UniProtKB/TrEMBL
	D4ACA2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-23	N6amt1	N-6 adenine-specific DNA methyltransferase 1	N6amt1	N-6 adenine-specific DNA methyltransferase 1 (putative)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	N6amt1	N-6 adenine-specific DNA methyltransferase 1 (putative)	Hemk2_predicted	HemK methyltransferase family member 2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Hemk2_predicted	HemK methyltransferase family member 2 (predicted)	RGD1311843_predicted	similar to N6-DNA-methyltransferase isoform 1 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1311843_predicted	similar to N6-DNA-methyltransferase isoform 1 (predicted)	LOC288309_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC288309_predicted	similar to N6-DNA-methyltransferase isoform 1 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message