Advanced Search (OLGA)

Gene: Nmi (N-myc (and STAT) interactor) Rattus norvegicus

Analyze

Symbol:

Nmi

Name:

N-myc (and STAT) interactor

RGD ID:

1311721

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of non-canonical NF-kappaB signal transduction. Predicted to act upstream of or within negative regulation of innate immune response; negative regulation of type I interferon production; and positive regulation of protein K48-linked ubiquitination. Predicted to be located in several cellular components, including cytosol; extracellular space; and nucleus. Predicted to be active in cytoplasm. Orthologous to human NMI (N-myc and STAT interactor); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC311021; MGC112791; N-myc-interactor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NMI (N-myc and STAT interactor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nmi (N-myc (and STAT) interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nmi (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NMI (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NMI (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nmi (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NMI (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NMI (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nmi (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nmi (N-myc and STAT interactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NMI (N-myc and STAT interactor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NMI (N-myc and STAT interactor)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nmi (N-myc (and STAT) interactor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nmi (N-myc (and STAT) interactor)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nmi (N-myc (and STAT) interactor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nmi	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nmi	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)

Candidate Gene For:

Arunc3

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	56,824,778 - 56,848,891 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	56,811,314 - 56,848,717 (-)	Ensembl				GRCr8
mRatBN7.2	3	36,415,607 - 36,439,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	36,415,607 - 36,439,498 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	39,801,525 - 39,825,145 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	48,386,311 - 48,409,932 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	46,170,865 - 46,194,485 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	37,458,891 - 37,480,984 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	37,458,890 - 37,480,984 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	42,562,213 - 42,584,322 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	32,962,021 - 32,996,031 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	34,561,381 - 34,584,783 (-)	NCBI		Celera
RGSC_v3.1	3	32,869,644 - 32,892,452 (-)	NCBI
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

5-azacytidine (ISO)

acetamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

bathocuproine disulfonic acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butyric acid (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dimethyl sulfoxide (ISO)

diuron (ISO)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

flutamide (EXP)

gentamycin (EXP)

hydrogen peroxide (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

ionomycin (ISO)

methapyrilene (EXP)

methidathion (ISO)

methylseleninic acid (ISO)

nickel atom (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

potassium chromate (ISO)

pyrrolidine dithiocarbamate (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thiophenes (ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

immune system process (IEA)

innate immune response (IEA)

macrophage activation involved in immune response (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of innate immune response (ISO)

negative regulation of interferon-alpha production (ISO)

negative regulation of interferon-beta production (ISO)

negative regulation of non-canonical NF-kappaB signal transduction (ISO)

negative regulation of type I interferon production (ISO)

positive regulation of inflammatory response (IEA,ISO)

positive regulation of innate immune response (IEA,ISO)

positive regulation of non-canonical NF-kappaB signal transduction (ISO)

positive regulation of protein K48-linked ubiquitination (ISO)

response to virus (ISO)

toll-like receptor 4 signaling pathway (ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (ISO)

extracellular region (IEA)

extracellular space (IEA,ISO)

membrane (ISO)

nucleus (IEA,ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:10597290	PMID:12477932	PMID:21516116	PMID:23956435	PMID:24936061	PMID:25416956

Genomics

Comparative Map Data

Nmi
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	56,824,778 - 56,848,891 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	56,811,314 - 56,848,717 (-)	Ensembl				GRCr8
mRatBN7.2	3	36,415,607 - 36,439,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	36,415,607 - 36,439,498 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	39,801,525 - 39,825,145 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	48,386,311 - 48,409,932 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	46,170,865 - 46,194,485 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	37,458,891 - 37,480,984 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	37,458,890 - 37,480,984 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	42,562,213 - 42,584,322 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	32,962,021 - 32,996,031 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	34,561,381 - 34,584,783 (-)	NCBI		Celera
RGSC_v3.1	3	32,869,644 - 32,892,452 (-)	NCBI
Cytogenetic Map	3	q12	NCBI

NMI
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	151,270,470 - 151,289,668 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	151,270,467 - 151,289,908 (-)	Ensembl			hg38	GRCh38
GRCh37	2	152,126,984 - 152,146,182 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	151,835,231 - 151,854,620 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	151,952,492 - 151,971,882	NCBI
Celera	2	145,741,245 - 145,760,697 (-)	NCBI		Celera
Cytogenetic Map	2	q23.3	NCBI
HuRef	2	144,023,466 - 144,042,922 (-)	NCBI		HuRef
CHM1_1	2	152,132,823 - 152,152,267 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	151,722,213 - 151,741,416 (-)	NCBI		T2T-CHM13v2.0

Nmi
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	51,838,517 - 51,863,241 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	51,838,499 - 51,863,506 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	51,948,498 - 51,973,489 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	51,948,487 - 51,973,494 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	51,804,019 - 51,828,728 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	51,770,514 - 51,795,099 (-)	NCBI		MGSCv36	mm8
Celera	2	53,673,337 - 53,698,210 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	29.98	NCBI

Nmi
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955440	16,848,108 - 16,877,674 (-)	Ensembl
ChiLan1.0	NW_004955440	16,850,469 - 16,877,295 (-)	NCBI	ChiLan1.0	ChiLan1.0

NMI
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	23,641,380 - 23,670,320 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	23,656,239 - 23,685,288 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	8,574,385 - 8,603,486 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	155,802,720 - 155,831,938 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	155,802,720 - 155,823,142 (-)	Ensembl			panPan2	panpan1.1

NMI
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	52,541,796 - 52,555,043 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	52,541,981 - 52,553,574 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	52,655,038 - 52,668,288 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	54,020,442 - 54,033,937 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	54,010,041 - 54,037,008 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	52,708,400 - 52,723,141 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	52,786,648 - 52,799,912 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	54,251,499 - 54,268,580 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nmi
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	115,402,813 - 115,423,388 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	26,194,192 - 26,214,949 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	26,194,237 - 26,215,244 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NMI
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	941,475 - 967,321 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	941,379 - 966,519 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	3,987 - 29,195 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NMI
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	36,702,056 - 36,722,494 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	36,702,068 - 36,715,809 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	162,823,454 - 162,838,996 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nmi
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624866	4,229,535 - 4,263,688 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624866	4,230,258 - 4,263,156 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nmi
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	29,729,268 - 29,745,070 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nmi
163 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	44
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000030373
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
1298073	Cm13	Cardiac mass QTL 13	2.5		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	45423609	58601291	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	47904172	70710963	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	47904172	70710963	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	47904172	70710963	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	37796919	59119581	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat

Markers in Region

RH143049

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	3	42,554,211 - 42,554,353	NCBI	Rnor5.0
RGSC_v3.4	3	32,962,706 - 32,962,902	UniSTS	RGSC3.4
Celera	3	34,556,658 - 34,556,854	UniSTS
RH 3.4 Map	3	424.91	UniSTS
Cytogenetic Map	3	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC100089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030373 ⟹ ENSRNOP00000035928

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	56,825,087 - 56,847,572 (-)	Ensembl
mRatBN7.2 Ensembl	3	36,415,912 - 36,439,498 (-)	Ensembl
Rnor_6.0 Ensembl	3	37,458,890 - 37,480,984 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098879 ⟹ ENSRNOP00000086226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	56,825,087 - 56,840,501 (-)	Ensembl
mRatBN7.2 Ensembl	3	36,415,607 - 36,439,420 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172298 ⟹ ENSRNOP00000103512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	56,811,314 - 56,848,717 (-)	Ensembl

RefSeq Acc Id:

NM_001034148 ⟹ NP_001029320

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	56,825,080 - 56,848,543 (-)	NCBI
mRatBN7.2	3	36,415,909 - 36,439,375 (-)	NCBI
Rnor_6.0	3	37,458,891 - 37,480,984 (-)	NCBI
Rnor_5.0	3	42,562,213 - 42,584,322 (-)	NCBI
RGSC_v3.4	3	32,962,021 - 32,996,031 (-)	RGD
Celera	3	34,561,381 - 34,584,783 (-)	RGD

Sequence:

show sequence

GCGCTGCGCGGCAGAGAGGGGCGTCATGGATAACAACGTAAGGCAAGCTTATGAAGAGTGCTCA
CCAGAGAAGGACATCATGAGAGGCGAACAAAGGATTACTTCATGAAATTATGAGGGAAAACAGC
AAGCTAGACGAGGAGATCAAAAAACTTGAAGCTGAATTGCAGTCGAATGCCAGAGAATTCCAAA
TTAAAGAGAATGTACCAGAAAGAAAGCTTAAATTCACCTCTGTGGAGAGACCCGAGGATGGAGA
CCATTTCTCAAATAGCTCCTGTTCATTTCAAGTGAACTCGCAAATTCTTTATGAGGTACAGAGA
GGACAAGCGCTTATCACCTTTGAGAAGGAAGAAGTTGCACAGAACGTGATATCGATGGGGACGC
ATGTCGTGCAGATGGAAGGCACCTCGGTGAAGGTCTCTGCACACCCAGTCCCACTGAGCACAGG
TGTCAGATTTCAGGTTCATGTGGACATTTCTAAAATGAAGATCAATGTTACGGGGATTCCCGAT
GAACTGTCTGAGGAGCAGACAAGGGACAAGCTGGAGCTGAGCTTCTATAAGTCCAAGAATGGCG
GCGGAGAAGTGGAAAGTGTAGACTATGACAGGAAGTCCAGAAGCGCTGTCATCACATTTGTGGT
AGCTGGAGTTGCTGACAAGATTTTGAAAAAGAAAACCTATCCTCTCTACATGAATCAGAAGTGG
TATAACGTGACTGTTTCCCCATTTATAGAAAGACGCTTGGAAAAGTACCAGGTGTTTTCAGCTG
TGTCCAAGAAGACAGTACTTCTGACTGGATTAGACGGCATTCGTGTAGATGAGGAGACTGGGGA
AGACTTACTCAACATCCACTTCCAACGGAAGAATAACGGAGGGGGAGAAGTGGAGGTGGTCAAG
TGTTCTCTAGATCAGTCCTTCATAGCATGTTTCGAAGAAGAGGCCAGAGGAACCACATGAAACT
TACAGCTCTGAGCCCAAATCATTGTCAACATTTATGAAATATTGTTTTCCTTAACAATAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104811 ⟹ XP_038960739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	56,824,778 - 56,848,891 (-)	NCBI
mRatBN7.2	3	36,415,607 - 36,439,715 (-)	NCBI

RefSeq Acc Id:

XM_039104812 ⟹ XP_038960740

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	56,824,778 - 56,848,840 (-)	NCBI
mRatBN7.2	3	36,415,607 - 36,439,685 (-)	NCBI

RefSeq Acc Id:

XM_039104813 ⟹ XP_038960741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	56,824,778 - 56,848,880 (-)	NCBI
mRatBN7.2	3	36,415,607 - 36,439,716 (-)	NCBI

RefSeq Acc Id:

XM_039104814 ⟹ XP_038960742

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	56,824,778 - 56,848,841 (-)	NCBI
mRatBN7.2	3	36,415,607 - 36,439,685 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029320	(Get FASTA)	NCBI Sequence Viewer
	NP_001418544	(Get FASTA)	NCBI Sequence Viewer
	NP_001418545	(Get FASTA)	NCBI Sequence Viewer
	NP_001418546	(Get FASTA)	NCBI Sequence Viewer
	XP_038960739	(Get FASTA)	NCBI Sequence Viewer
	XP_038960740	(Get FASTA)	NCBI Sequence Viewer
	XP_038960741	(Get FASTA)	NCBI Sequence Viewer
	XP_038960742	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00090	(Get FASTA)	NCBI Sequence Viewer
	EDM00444	(Get FASTA)	NCBI Sequence Viewer
	EDM00445	(Get FASTA)	NCBI Sequence Viewer
	EDM00446	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035928
	ENSRNOP00000035928.6
	ENSRNOP00000086226
	ENSRNOP00000086226.1
	ENSRNOP00000103512
	ENSRNOP00000103512.1

RefSeq Acc Id:

NP_001029320 ⟸ NM_001034148

- UniProtKB:

Q498S7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRENSKLDEEIKKLEAELQSNAREFQIKENVPERKLKFTSVERPEDGDHFSNSSCSFQVNSQIL
YEVQRGQALITFEKEEVAQNVISMGTHVVQMEGTSVKVSAHPVPLSTGVRFQVHVDISKMKINV
TGIPDELSEEQTRDKLELSFYKSKNGGGEVESVDYDRKSRSAVITFVVAGVADKILKKKTYPLY
MNQKWYNVTVSPFIERRLEKYQVFSAVSKKTVLLTGLDGIRVDEETGEDLLNIHFQRKNNGGGE
VEVVKCSLDQSFIACFEEEARGTT

hide sequence

Ensembl Acc Id:

ENSRNOP00000035928 ⟸ ENSRNOT00000030373

RefSeq Acc Id:	XP_038960741 ⟸ XM_039104813
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960739 ⟸ XM_039104811
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960742 ⟸ XM_039104814
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960740 ⟸ XM_039104812
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A371 (UniProtKB/TrEMBL), A6JF14 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000086226 ⟸ ENSRNOT00000098879

Ensembl Acc Id:

ENSRNOP00000103512 ⟸ ENSRNOT00000172298

Protein Domains

NID Nmi/IFP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LQS0-F1-model_v2	AlphaFold	F1LQS0	1-215	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692075

Promoter ID:

EPDNEW_R2599

Type:

initiation region

Name:

Nmi_1

Description:

N-myc interactor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	37,481,065 - 37,481,125	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311721	AgrOrtholog
BioCyc Gene	G2FUF-49738	BioCyc
Ensembl Genes	ENSRNOG00000027502	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030373	ENTREZGENE
	ENSRNOT00000030373.6	UniProtKB/TrEMBL
	ENSRNOT00000098879	ENTREZGENE
	ENSRNOT00000098879.2	UniProtKB/TrEMBL
	ENSRNOT00000172298	ENTREZGENE
	ENSRNOT00000172298.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7371417	IMAGE-MGC_LOAD
InterPro	Interferon_induced_35kDa_N	UniProtKB/TrEMBL
	Nmi/IFP35	UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
KEGG Report	rno:311021	UniProtKB/TrEMBL
MGC_CLONE	MGC:112791	IMAGE-MGC_LOAD
NCBI Gene	311021	ENTREZGENE
PANTHER	INTERFERON-INDUCED PROTEIN 35/NMI N-MYC/STAT INTERACTING PROTEIN	UniProtKB/TrEMBL
	PTHR15225:SF4	UniProtKB/TrEMBL
Pfam	IFP_35_N	UniProtKB/TrEMBL
	NID	UniProtKB/TrEMBL
PhenoGen	Nmi	PhenoGen
RatGTEx	ENSRNOG00000027502	RatGTEx
UniProt	A0A8I6A371	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0L347_RAT	UniProtKB/TrEMBL
	A6JF14	ENTREZGENE, UniProtKB/TrEMBL
	F1LQS0_RAT	UniProtKB/TrEMBL
	Q498S7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Nmi	N-myc (and STAT) interactor	Nmi_predicted	N-myc (and STAT) interactor (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Nmi_predicted	N-myc (and STAT) interactor (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD