Advanced Search (OLGA)

Gene: Smtnl1 (smoothelin-like 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Smtnl1

Name:

smoothelin-like 1

RGD ID:

1311701

Description:

Predicted to enable several functions, including calmodulin binding activity; protein domain specific binding activity; and protein phosphatase 1 binding activity. Predicted to be involved in negative regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including blood vessel diameter maintenance; peptidyl-serine phosphorylation; and response to activity. Predicted to be located in I band; M band; and nucleus. Orthologous to human SMTNL1 (smoothelin like 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC311167; RGD1311701; similar to RIKEN cDNA 1110030K22; smoothelin-like protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SMTNL1 (smoothelin like 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Smtnl1 (smoothelin-like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Smtnl1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SMTNL1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SMTNL1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Smtnl1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SMTNL1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SMTNL1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Smtnl1 (smoothelin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Smtnl1 (smoothelin-like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SMTNL1 (smoothelin like 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	90,295,682 - 90,307,769 (-)	NCBI		GRCr8
mRatBN7.2	3	69,889,010 - 69,901,096 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	69,889,010 - 69,901,079 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	73,270,699 - 73,278,699 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	81,869,366 - 81,877,366 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	79,628,355 - 79,636,353 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	72,207,150 - 72,219,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	72,207,113 - 72,219,246 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	78,728,182 - 78,740,150 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	68,017,296 - 68,025,299 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	67,913,666 - 67,921,671 (-)	NCBI
Celera	3	69,248,302 - 69,252,187 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Smtnl1	Rat	intellectual disability		ISO	SMTNL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Smtnl1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SMTNL1 mRNA	CTD	PMID:32109520
Smtnl1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SMTNL1 mRNA	CTD	PMID:35163327
Smtnl1	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of SMTNL1 mRNA	CTD	PMID:35163327
Smtnl1	Rat	aristolochic acid A	increases expression	ISO	SMTNL1 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of SMTNL1 mRNA	CTD	PMID:33212167
Smtnl1	Rat	benzo[a]pyrene	decreases expression	ISO	Smtnl1 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of SMTNL1 mRNA	CTD	PMID:22228805
Smtnl1	Rat	benzo[a]pyrene	affects methylation	ISO	SMTNL1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SMTNL1 promoter	CTD	PMID:27901495
Smtnl1	Rat	benzo[a]pyrene	decreases methylation	ISO	SMTNL1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of SMTNL1 exon	CTD	PMID:27901495
Smtnl1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SMTNL1 mRNA	CTD	PMID:25181051
Smtnl1	Rat	bisphenol A	decreases expression	ISO	Smtnl1 (Mus musculus)	6480464	bisphenol A results in decreased expression of SMTNL1 mRNA	CTD	PMID:34585602
Smtnl1	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of SMTNL1 mRNA	CTD	PMID:19167457
Smtnl1	Rat	chrysene	increases expression	ISO	Smtnl1 (Mus musculus)	6480464	chrysene results in increased expression of SMTNL1 mRNA	CTD	PMID:26377693
Smtnl1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of SMTNL1 mRNA	CTD	PMID:23914054
Smtnl1	Rat	paracetamol	increases expression	ISO	SMTNL1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of SMTNL1 mRNA	CTD	PMID:29067470
Smtnl1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SMTNL1 mRNA	CTD	PMID:35163327
Smtnl1	Rat	pioglitazone	multiple interactions	ISO	Smtnl1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of SMTNL1 mRNA	CTD	PMID:27935865
Smtnl1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of SMTNL1 mRNA	CTD	PMID:33387578
Smtnl1	Rat	triphenyl phosphate	affects expression	ISO	SMTNL1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SMTNL1 mRNA	CTD	PMID:37042841

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Smtnl1	Rat	muscle organ morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	muscle organ morphogenesis	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	MGI:3796616 PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	negative regulation of DNA-templated transcription	involved_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:21771785	RGD	PMID:21771785
Smtnl1	Rat	negative regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	peptidyl-serine phosphorylation	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	positive regulation of vasoconstriction	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	MGI:3796616 PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	positive regulation of vasoconstriction	acts_upstream_of_or_within	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	positive regulation of vasoconstriction	involved_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:20634291	RGD	PMID:20634291
Smtnl1	Rat	response to activity	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	MGI:3796616 PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	response to activity	acts_upstream_of_or_within	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	response to xenobiotic stimulus	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	response to xenobiotic stimulus	acts_upstream_of_or_within	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	vasoconstriction	acts_upstream_of_or_within	ISO	Smtnl1 (Mus musculus)	1624291	MGI:3796616 PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	vasoconstriction	acts_upstream_of_or_within	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Smtnl1	Rat	contractile muscle fiber	located_in	ISO	SMTNL1 (Homo sapiens)	1624291	PMID:20634291	RGD	PMID:20634291
Smtnl1	Rat	contractile muscle fiber	located_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	contractile muscle fiber	located_in	IEA	UniProtKB:A8MU46 and ensembl:ENSP00000432651	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	contractile muscle fiber	located_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:18310078 and PMID:20634291	RGD	PMID:18310078 and PMID:20634291
Smtnl1	Rat	cytoplasm	located_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:20634291	RGD	PMID:20634291
Smtnl1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	I band	located_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	I band	located_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	M band	located_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:18310078	RGD	PMID:18310078
Smtnl1	Rat	M band	located_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	nucleus	located_in	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	nucleus	located_in	ISO	Smtnl1 (Mus musculus)	1624291	PMID:20634291	RGD	PMID:20634291

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Smtnl1	Rat	calmodulin binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:P62149 and PMID:18477568	RGD	PMID:18477568
Smtnl1	Rat	calmodulin binding	enables	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	CH domain binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:Q99LM3 and PMID:22424482	RGD	PMID:22424482
Smtnl1	Rat	CH domain binding	enables	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	disordered domain specific binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:Q99LM3 and PMID:22424482	RGD	PMID:22424482
Smtnl1	Rat	disordered domain specific binding	enables	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	protein binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:P04268 and PMID:20627103	RGD	PMID:20627103
Smtnl1	Rat	protein phosphatase 1 binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:Q9DBR7 and PMID:20634291	RGD	PMID:20634291
Smtnl1	Rat	protein phosphatase 1 binding	enables	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Smtnl1	Rat	tropomyosin binding	enables	ISO	Smtnl1 (Mus musculus)	1624291	UniProtKB:P04268 more ...	RGD	PMID:22424482
Smtnl1	Rat	tropomyosin binding	enables	IEA	UniProtKB:Q99LM3 and ensembl:ENSMUSP00000028471	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18310078	PMID:18477568	PMID:20634291	PMID:21771785	PMID:22424482	PMID:25923522

Smtnl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	90,295,682 - 90,307,769 (-)	NCBI		GRCr8
mRatBN7.2	3	69,889,010 - 69,901,096 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	69,889,010 - 69,901,079 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	73,270,699 - 73,278,699 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	81,869,366 - 81,877,366 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	79,628,355 - 79,636,353 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	72,207,150 - 72,219,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	72,207,113 - 72,219,246 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	78,728,182 - 78,740,150 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	68,017,296 - 68,025,299 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	67,913,666 - 67,921,671 (-)	NCBI
Celera	3	69,248,302 - 69,252,187 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

SMTNL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	57,537,595 - 57,550,272 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	57,537,595 - 57,550,272 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	57,305,068 - 57,317,745 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	57,065,555 - 57,074,684 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	54,666,633 - 54,674,266 (+)	NCBI		Celera
Cytogenetic Map	11	q12.1	NCBI
HuRef	11	53,658,903 - 53,666,539 (+)	NCBI		HuRef
CHM1_1	11	57,176,354 - 57,183,988 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	57,487,765 - 57,500,440 (+)	NCBI		T2T-CHM13v2.0

Smtnl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	84,641,494 - 84,657,173 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	84,641,520 - 84,652,996 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	84,811,173 - 84,826,847 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	84,811,176 - 84,822,652 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	84,651,333 - 84,662,809 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	84,612,015 - 84,623,491 (-)	NCBI		MGSCv36	mm8
Celera	2	86,406,709 - 86,421,097 (-)	NCBI		Celera
Cytogenetic Map	2	D	NCBI
cM Map	2	49.45	NCBI

Smtnl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955511	2,515,651 - 2,521,077 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955511	2,512,950 - 2,521,200 (+)	NCBI	ChiLan1.0	ChiLan1.0

SMTNL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	58,692,926 - 58,706,659 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	59,713,177 - 59,725,017 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	52,777,777 - 52,792,165 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	56,250,161 - 56,262,842 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	56,255,219 - 56,262,685 (+)	Ensembl	panpan1.1		panPan2

SMTNL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	38,620,810 - 38,632,580 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	38,621,066 - 38,628,762 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	38,166,926 - 38,178,671 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	39,302,779 - 39,314,560 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	39,303,092 - 39,314,489 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	38,885,372 - 38,897,148 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	38,459,013 - 38,470,701 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	39,089,411 - 39,101,187 (-)	NCBI		UU_Cfam_GSD_1.0

Smtnl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	14,841,247 - 14,851,914 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	4,955,071 - 4,965,785 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	4,955,072 - 4,965,760 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SMTNL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	13,370,920 - 13,384,843 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SMTNL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	15,682,270 - 15,697,126 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	15,679,502 - 15,696,462 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	113,036,406 - 113,044,258 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Smtnl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624864	3,114,210 - 3,121,831 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Smtnl1
65 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	75
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000009903
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	11	25	30	65	67	41	18	41	6	150	59	17	38	53	26


RefSeq Transcripts	NM_001191739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009903 ⟹ ENSRNOP00000009903

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	69,889,170 - 69,901,079 (-)	Ensembl
Rnor_6.0 Ensembl	3	72,207,113 - 72,219,246 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102834 ⟹ ENSRNOP00000095023

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	69,889,170 - 69,901,079 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114989 ⟹ ENSRNOP00000080077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	69,889,010 - 69,897,063 (-)	Ensembl

RefSeq Acc Id:

NM_001191739 ⟹ NP_001178668

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	90,295,682 - 90,303,736 (-)	NCBI
mRatBN7.2	3	69,889,010 - 69,897,063 (-)	NCBI
Rnor_6.0	3	72,207,151 - 72,215,210 (-)	NCBI
Rnor_5.0	3	78,728,182 - 78,740,150 (-)	NCBI
Celera	3	69,248,302 - 69,252,187 (-)	NCBI

Sequence:

show sequence

ATGGAACAGACAGAAGGGAACCCCTCTGAGGATGGGACCACTGTCTCCCCAACTGCAGGGAATCTTGCAACACCAGGAAGTCAAGGCACTGCAGAAGAGGTGGCCGAAGGCACTGCAGAAGAGGTGGC
CGAAGGCACAGTTGGGACAAATGACAAAGAAGAGCCTCCAGATGGGGCAGAACATTTGTGTAAAGCAGCATCTGAGGGTGGTATATCAGGGGGATGCCAGGTGGAAGCAAGTATATTAGAGGAGCTCA
AGACAGACTCGCAAGGGGAGGCCAGAGGGAAGGAGGAAGCCAAGGCTGACCTTGCCGAGGAGAAAGGTGGGAAGGAAGACACCACAGTGTCTTCTCAGGAAGACACTGGTAAGAAAGAAGAGACAAAA
CCTGAACCCAGTGAGGTTACGGAGAAAGAGGAAGCCGTGCTGCCCTTGGAGAAGCAGAAGGTTGATGAGAAAGAGACCAATCTAGAATCTAAGGAGAAATCAGATGTGAATGATAAGGCTGAGCCTGA
ATCCAAGGAGGATGCTGGAGCAGAGGTTACTGTCAAAGAGGCTGAGACTGAATCTCAAAAGAAGGCTGATGTGAAAGACCAGGCCGAGCCTCAGCTTCAGGAAGTTGATGGGAAAGAGGCCAGAAGTG
ACACAAAGGAGTTGGTGGAGCCAGGGAGTCCCACTGAAGAGCAGGAGGAACAAGGTAAGGAAAATGAATCAGAAGAAAGGGCAGCGGTGATTCCCAGCTCCCCCGAGGACTGGCCCGAGAGCCCCACA
GATGAGGGGACCAGCCTCAGCCCAGATGGGTTGGGTCCAGAGTCTACAGCATCTGGAGAGACCAGTGCTTCAGCCAGTGAATCTTCGCCCAGTGAGGTGCCAGAGAGCCCCACAGAGCCCCTTCCCTC
GGAGAAAAAGAAGGAACGGGCACCAGAACGCAGGGTGTCGGCCCCCACCCGGCCCCGAGGGCCACGTGCACAGAATCGGAAGGCCATCATGGACAAATTTGGCGGGGCAGCCTCTGGCCCCACTGCAC
TGTTCCGGAACACAAAGGCAGCCGGGGCAGCCATTGGTGGTGTTAAGAACATGCTTTTGGAGTGGTGCCGGGCCATGACGAGAAACTACGAGCACGTGGACATCCAAAACTTCTCCTCCAGCTGGAGC
AGCGGCATGGCCTTCTGTGCCCTCATCCACAAGTTTTTTCCAGACGCCTTTGACTATGCAGAGCTGGACCCAACAAAGCGCCGGCACAACTTCACGCTAGCTTTCTCTACTGCAGAGAAACTAGCCGA
CTGCGCCCAGCTGCTGGAGGTGGATGACATGGTGCGGCTGGCAGTGCCCGATTCCAAGTGTGTCTACACTTACATCCAGGAGCTATACCGTAGCCTTGTACAGAAAGGGCTGGTGAAGACGAAAAAGA
AATGAATGGCAAAGCCGTGCGGGAGGAGGAAGCGGGGACTGCTGCCAACCATGGCCTCGAGGTGCTCTTATACCACCAGGCATAAAACGGGTGGCACCGGCCTCAACGACATTAAAAGTACTTCTGCA
AAATTCCTCTCATTCCTTGCTGCTCCCCAAACGCATCCCAACCAGACACACATACGTACTAGGCGATGGCCAAAAATAAAAGAAACCTGCATTCGCAGCC

hide sequence

RefSeq Acc Id:

XM_006234464 ⟹ XP_006234526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	90,295,685 - 90,307,769 (-)	NCBI
mRatBN7.2	3	69,889,013 - 69,901,096 (-)	NCBI
Rnor_6.0	3	72,207,150 - 72,219,209 (-)	NCBI
Rnor_5.0	3	78,728,182 - 78,740,150 (-)	NCBI

Sequence:

show sequence

TCTTGAAGGTGGGGTGGGGTGGGGTGGAAGTAAAAGCCACCAGAGCTTAAAGGACGATGGGAGGGAGGCTACTCAGCTAGAACGAGGCAAGAGCTCCAAGCTGCAGGCAGAACCCCACAGACATGGAA
CAGACAGAAGGGAACCCCTCTGAGGATGGGACCACTGTCTCCCCAACTGCAGGGAATCTTGCAACACCAGGAAGTCAAGGCACTGCAGAAGAGGTGGCCGAAGGCACTGCAGAAGAGGTGGCCGAAGG
CACAGTTGGGACAAATGACAAAGAAGAGCCTCCAGATGGGGCAGAACATTTGTGTAAAGCAGCATCTGAGGGTGGTATATCAGGGGGATGCCAGGTGGAAGCAAGTATATTAGAGGAGCTCAAGACAG
ACTCGCAAGGGGAGGCCAGAGGGAAGGAGGAAGCCAAGGCTGACCTTGCCGAGGAGAAAGGTGGGAAGGAAGACACCACAGTGTCTTCTCAGGAAGACACTGGTAAGAAAGAAGAGACAAAACCTGAA
CCCAGTGAGGTTACGGAGAAAGAGGAAGCCGTGCTGCCCTTGGAGAAGCAGAAGGTTGATGAGAAAGAGACCAATCTAGAATCTAAGGAGAAATCAGATGTGAATGATAAGGCTGAGCCTGAATCCAA
GGAGGATGCTGGAGCAGAGGTTACTGTCAAAGAGGCTGAGACTGAATCTCAAAAGAAGGCTGATGTGAAAGACCAGGCCGAGCCTCAGCTTCAGGAAGTTGATGGGAAAGAGGCCAGAAGTGACACAA
AGGAGTTGGTGGAGCCAGGGAGTCCCACTGAAGAGCAGGAGGAACAAGGTAAGGAAAATGAATCAGAAGAAAGGGCAGCGGTGATTCCCAGCTCCCCCGAGGACTGGCCCGAGAGCCCCACAGATGAG
GGGACCAGCCTCAGCCCAGATGGGTTGGGTCCAGAGTCTACAGCATCTGGAGAGACCAGTGCTTCAGCCAGTGAATCTTCGCCCAGTGAGGTGCCAGAGAGCCCCACAGAGCCCCTTCCCTCGGAGAA
AAAGAAGGAACGGGCACCAGAACGCAGGGTGTCGGCCCCCACCCGGCCCCGAGGGCCACGTGCACAGAATCGGAAGGCCATCATGGACAAATTTGGCGGGGCAGCCTCTGGCCCCACTGCACTGTTCC
GGAACACAAAGGCAGCCGGGGCAGCCATTGGTGGTGTTAAGAACATGCTTTTGGAGTGGTGCCGGGCCATGACGAGAAACTACGAGCACGTGGACATCCAAAACTTCTCCTCCAGCTGGAGCAGCGGC
ATGGCCTTCTGTGCCCTCATCCACAAGTTTTTTCCAGACGCCTTTGACTATGCAGAGCTGGACCCAACAAAGCGCCGGCACAACTTCACGCTAGCTTTCTCTACTGCAGAGAAACTAGCCGACTGCGC
CCAGCTGCTGGAGGTGGATGACATGGTGCGGCTGGCAGTGCCCGATTCCAAGTGTGTCTACACTTACATCCAGGAGCTATACCGTAGCCTTGTACAGAAAGGGCTGGTGAAGACGAAAAAGAAATGAA
TGGCAAAGCCGTGCGGGAGGAGGAAGCGGGGACTGCTGCCAACCATGGCCTCGAGGTGCTCTTATACCACCAGGCATAAAACGGGTGGCACCGGCCTCAACGACATTAAAAGTACTTCTGCAAAATTC
CTCTCATTCCTTGCTGCTCCCCAAACGCATCCCAACCAGACACACATACGTACTAGGCGATGGCCAAAAATAAAAGAAACCTGCATTCGCAGCCA

hide sequence


Protein RefSeqs	NP_001178668	(Get FASTA)	NCBI Sequence Viewer
	XP_006234526	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79318	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009903
	ENSRNOP00000009903.5
	ENSRNOP00000080077
	ENSRNOP00000080077.1
	ENSRNOP00000095023.1

RefSeq Acc Id:

NP_001178668 ⟸ NM_001191739

- UniProtKB:

D3ZWP4 (UniProtKB/TrEMBL), A0A8I5ZP11 (UniProtKB/TrEMBL), A0A8I6ALV6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEQTEGNPSEDGTTVSPTAGNLATPGSQGTAEEVAEGTAEEVAEGTVGTNDKEEPPDGAEHLCKAASEGGISGGCQVEASILEELKTDSQGEARGKEEAKADLAEEKGGKEDTTVSSQEDTGKKEETK
PEPSEVTEKEEAVLPLEKQKVDEKETNLESKEKSDVNDKAEPESKEDAGAEVTVKEAETESQKKADVKDQAEPQLQEVDGKEARSDTKELVEPGSPTEEQEEQGKENESEERAAVIPSSPEDWPESPT
DEGTSLSPDGLGPESTASGETSASASESSPSEVPESPTEPLPSEKKKERAPERRVSAPTRPRGPRAQNRKAIMDKFGGAASGPTALFRNTKAAGAAIGGVKNMLLEWCRAMTRNYEHVDIQNFSSSWS
SGMAFCALIHKFFPDAFDYAELDPTKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK

hide sequence

RefSeq Acc Id:

XP_006234526 ⟸ XM_006234464

- Peptide Label:

isoform X1

- Sequence:

show sequence

MEQTEGNPSEDGTTVSPTAGNLATPGSQGTAEEVAEGTAEEVAEGTVGTNDKEEPPDGAEHLCKAASEGGISGGCQVEASILEELKTDSQGEARGKEEAKADLAEEKGGKEDTTVSSQEDTGKKEETK
PEPSEVTEKEEAVLPLEKQKVDEKETNLESKEKSDVNDKAEPESKEDAGAEVTVKEAETESQKKADVKDQAEPQLQEVDGKEARSDTKELVEPGSPTEEQEEQGKENESEERAAVIPSSPEDWPESPT
DEGTSLSPDGLGPESTASGETSASASESSPSEVPESPTEPLPSEKKKERAPERRVSAPTRPRGPRAQNRKAIMDKFGGAASGPTALFRNTKAAGAAIGGVKNMLLEWCRAMTRNYEHVDIQNFSSSWS
SGMAFCALIHKFFPDAFDYAELDPTKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000009903 ⟸ ENSRNOT00000009903

Ensembl Acc Id:

ENSRNOP00000080077 ⟸ ENSRNOT00000114989

Ensembl Acc Id:

ENSRNOP00000095023 ⟸ ENSRNOT00000102834

Protein Domains

Calponin-homology (CH)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZWP4-F1-model_v2	AlphaFold	D3ZWP4	1-470	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692185

Promoter ID:

EPDNEW_R2710

Type:

multiple initiation site

Name:

Smtnl1_1

Description:

smoothelin-like 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	72,219,131 - 72,219,191	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-49154	BioCyc
Ensembl Genes	ENSRNOG00000007516	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009903	ENTREZGENE
	ENSRNOT00000009903.8	UniProtKB/TrEMBL
	ENSRNOT00000102834.1	UniProtKB/TrEMBL
	ENSRNOT00000114989	ENTREZGENE
	ENSRNOT00000114989.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.418.10	UniProtKB/TrEMBL
InterPro	Calponin-like_dom_sf	UniProtKB/TrEMBL
	Calponin_act-bd	UniProtKB/TrEMBL
	F-actin_Monoox_Mical	UniProtKB/TrEMBL
KEGG Report	rno:311167	UniProtKB/TrEMBL
NCBI Gene	311167	ENTREZGENE
PANTHER	CALPONIN HOMOLOGY DOMAIN-CONTAINING PROTEIN DDB_G0272472-RELATED	UniProtKB/TrEMBL
	SMOOTHELIN-LIKE PROTEIN 1	UniProtKB/TrEMBL
Pfam	PF00307	UniProtKB/TrEMBL
PhenoGen	Smtnl1	PhenoGen
PROSITE	PS50021	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007516	RatGTEx
SMART	SM00033	UniProtKB/TrEMBL
Superfamily-SCOP	Calponin-homology	UniProtKB/TrEMBL
UniProt	A0A8I5ZP11	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ALV6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZWP4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Smtnl1	smoothelin-like 1	Smtnl1_predicted	smoothelin-like 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Smtnl1_predicted	smoothelin-like 1 (predicted)	RGD1311701_predicted	similar to RIKEN cDNA 1110030K22 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1311701_predicted	similar to RIKEN cDNA 1110030K22 (predicted)	LOC311167_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC311167_predicted	similar to RIKEN cDNA 1110030K22 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar