Advanced Search (OLGA)

Gene: G0s2 (G0/G1switch 2) Rattus norvegicus

Analyze

Symbol:

G0s2

Name:

G0/G1switch 2

RGD ID:

1311675

Description:

Predicted to be involved in extrinsic apoptotic signaling pathway; positive regulation of cold-induced thermogenesis; and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be active in mitochondrion. Orthologous to human G0S2 (G0/G1 switch 2); INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G0/G1 switch gene 2; G0/G1 switch protein 2; G0S2-like protein; LOC289388; putative lymphocyte G0/G1 switch

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	G0S2 (G0/G1 switch 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	G0s2 (G0/G1 switch gene 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	G0S2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	G0S2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	G0s2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	G0S2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	G0S2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	G0s2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	G0s2 (G0/G1 switch 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	G0s2 (G0/G1 switch gene 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	G0S2 (G0/G1 switch 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	g0s2 (G0/G1 switch 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	g0s2 (G0/G1 switch 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	107,335,036 - 107,335,948 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	107,335,036 - 107,336,293 (-)	Ensembl				GRCr8
mRatBN7.2	13	104,806,351 - 104,807,263 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	104,806,156 - 104,807,451 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	107,323,940 - 107,324,852 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	108,707,798 - 108,708,710 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	105,925,752 - 105,926,664 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	112,004,140 - 112,005,052 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	112,004,140 - 112,005,052 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	116,559,387 - 116,560,299 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	109,121,297 - 109,122,209 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	104,235,744 - 104,236,656 (-)	NCBI		Celera
RGSC_v3.1	13	109,310,400 - 109,311,313 (-)	NCBI
Cytogenetic Map	13	q27	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(2,4,5-trichlorophenoxy)acetic acid (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,10-heptadecafluoro-1-decanol (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3,7-dihydropurine-6-thione (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[b]fluorene (EXP)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bosentan (ISO)

buspirone (EXP)

butan-1-ol (ISO)

butyric acid (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

captan (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroethene (ISO)

chloropicrin (ISO)

chloroprene (EXP,ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt atom (ISO)

cobalt dichloride (ISO)

corn oil (EXP)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dichloroacetic acid (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

griseofulvin (ISO)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

indinavir (ISO)

indometacin (ISO)

irinotecan (EXP)

ketamine (EXP)

ketoconazole (ISO)

L-ascorbic acid (ISO)

lamivudine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

menadione (ISO)

mercaptopurine (EXP)

metacetamol (ISO)

metformin (EXP)

methylparaben (ISO)

mitomycin C (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

Muraglitazar (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

paclitaxel (EXP)

paracetamol (ISO)

paraquat (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenacetin (EXP)

phenobarbital (EXP,ISO)

phenylhydrazine (EXP)

phenylmercury acetate (ISO)

PhIP (EXP)

pirinixic acid (EXP,ISO)

poly(I:C) (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

purine-6-thiol (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

ritodrine (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

saquinavir (ISO)

SB 431542 (ISO)

selenium atom (ISO)

senecionine (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

sulfasalazine (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

topotecan (EXP)

tributylstannane (EXP)

trichloroethene (EXP,ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP,ISO)

Tungsten carbide (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vitamin E (ISO)

zearalenone (ISO)

zidovudine (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

extrinsic apoptotic signaling pathway (ISO,ISS)

positive regulation of cold-induced thermogenesis (ISO,ISS)

positive regulation of extrinsic apoptotic signaling pathway (IBA,ISO,ISS)

Cellular Component

mitochondrion (IBA,IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Mice lacking G0S2 are lean and cold-tolerant.	Ma T, etal., Cancer Biol Ther. 2014 May;15(5):643-50. doi: 10.4161/cbt.28251. Epub 2014 Feb 20.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:19706769	PMID:24344269	PMID:25448749	PMID:25588877	PMID:25811590	PMID:26511521	PMID:27590244	PMID:27624922

Genomics

Comparative Map Data

G0s2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	107,335,036 - 107,335,948 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	107,335,036 - 107,336,293 (-)	Ensembl				GRCr8
mRatBN7.2	13	104,806,351 - 104,807,263 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	104,806,156 - 104,807,451 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	107,323,940 - 107,324,852 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	108,707,798 - 108,708,710 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	105,925,752 - 105,926,664 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	112,004,140 - 112,005,052 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	112,004,140 - 112,005,052 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	116,559,387 - 116,560,299 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	109,121,297 - 109,122,209 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	104,235,744 - 104,236,656 (-)	NCBI		Celera
RGSC_v3.1	13	109,310,400 - 109,311,313 (-)	NCBI
Cytogenetic Map	13	q27	NCBI

G0S2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	209,675,412 - 209,676,390 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	209,675,412 - 209,676,390 (+)	Ensembl			hg38	GRCh38
GRCh37	1	209,848,757 - 209,849,735 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	207,915,388 - 207,916,356 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	183,079,559 - 183,080,622 (+)	NCBI		Celera
Cytogenetic Map	1	q32.2	NCBI
HuRef	1	180,523,941 - 180,525,004 (+)	NCBI		HuRef
CHM1_1	1	211,121,068 - 211,122,131 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	208,922,169 - 208,923,145 (+)	NCBI		T2T-CHM13v2.0

G0s2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	192,954,468 - 192,955,496 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	192,954,469 - 192,955,525 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	193,272,160 - 193,273,188 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	193,272,161 - 193,273,217 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	195,098,354 - 195,099,382 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	194,972,884 - 194,973,816 (-)	NCBI		MGSCv36	mm8
Celera	1	200,149,313 - 200,150,342 (-)	NCBI		Celera
Cytogenetic Map	1	H6	NCBI
cM Map	1	97.69	NCBI

G0S2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	39,724,827 - 39,725,986 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	39,691,065 - 39,692,224 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	185,251,903 - 185,252,882 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	190,056,941 - 190,058,086 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	190,057,382 - 190,057,693 (+)	Ensembl			panPan2	panpan1.1

G0S2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	8,335,699 - 8,336,615 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	8,336,015 - 8,336,302 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	7,913,309 - 7,913,983 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	8,036,582 - 8,037,512 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	8,036,912 - 8,037,199 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	7,966,401 - 7,967,331 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	8,063,456 - 8,064,386 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	8,124,418 - 8,125,348 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

G0s2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	66,187,875 - 66,188,880 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936557	3,426,525 - 3,429,479 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936557	3,428,157 - 3,429,176 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

G0S2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	133,287,325 - 133,287,742 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	133,287,065 - 133,288,066 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	146,493,448 - 146,494,458 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

G0S2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	19,778,518 - 19,779,589 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	19,778,753 - 19,779,475 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	20,378,108 - 20,379,266 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

G0s2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624807	2,317,557 - 2,318,951 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

G0s2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	71,259,255 - 71,260,200 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	49
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000007879
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

RH127314

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	104,806,444 - 104,806,656 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	112,004,234 - 112,004,445	NCBI	Rnor6.0
Rnor_5.0	13	116,559,481 - 116,559,692	UniSTS	Rnor5.0
RGSC_v3.4	13	109,121,391 - 109,121,602	UniSTS	RGSC3.4
Celera	13	104,235,838 - 104,236,049	UniSTS
RH 3.4 Map	13	761.7	UniSTS
Cytogenetic Map	13	q27	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007879 ⟹ ENSRNOP00000007879

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	107,335,036 - 107,336,293 (-)	Ensembl
mRatBN7.2 Ensembl	13	104,806,156 - 104,807,451 (-)	Ensembl
Rnor_6.0 Ensembl	13	112,004,140 - 112,005,052 (-)	Ensembl

RefSeq Acc Id:

NM_001009632 ⟹ NP_001009632

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	107,335,036 - 107,335,948 (-)	NCBI
mRatBN7.2	13	104,806,351 - 104,807,263 (-)	NCBI
Rnor_6.0	13	112,004,140 - 112,005,052 (-)	NCBI
Rnor_5.0	13	116,559,387 - 116,560,299 (-)	NCBI
RGSC_v3.4	13	109,121,297 - 109,122,209 (-)	RGD
Celera	13	104,235,744 - 104,236,656 (-)	RGD

Sequence:

show sequence

GGCCAGTCTGCCGCCTGGACGCCTGACCTCCTTCAGCGAGTGCTGCCTCTGTTCCCACGCACCC
TAGGCCCAGCCAACCCACAGCCCAGAGCTCAGATGGAAAGTGTGCAGGAGCTGATCCCTCTGGC
TAAGGAGATGATGACGCAGAAGTCCCGAGGGAAGCTAGTGAAGCTGTACGTGCTGGGCAGTGTG
CTAGCGTTCTTCGGTGTGGTGCTCGGTCTAGTGGAGACTGTGTGCAGCCCTTTCACAGCTGCCA
GCCGTCTGCGCGACCAGGAGGCGGCAGTGGCAGAGCTGCGGGATGCTTGTGAGCAGCAGTCCCT
CCACAAGCAGGCCCTGATAGCAGAAGGCAAGACACAGGAGGCGACTTTGTGCAGCCGGGCCCTG
TCCCTCCGGCAGCATGCCTCTTAAGGCTGGTGACTGGCAGAGAAGCGAGACACAGAGAGATCAT
GACTGAGGTGGGCGAGAGAGAGTCACATGCTGTTTCAAGGTGCCACCGAATCCAGAACTGACCC
TGCACAGATCACCCAAGGGATCTGGGACTGACTTGCTGCTGTGCAGCATGCACTGTGATTTGTC
CAAGGCTGTGGGAGCGATCAAGGAGCTGTCACTTTGCATTAGGGAAGGAGACATGCTTTTTATA
CTGTTATTTTTATTGTTGTTGTTATTATTATTATTATTATTACAACGAATATCATTTTGCATTT
TGAAATAAAAACATTTTATATTCTGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009632	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88248	(Get FASTA)	NCBI Sequence Viewer
	EDL95033	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007879.3
GenBank Protein	Q5M840	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009632 ⟸ NM_001009632
- UniProtKB:	Q5M840 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MESVQELIPLAKEMMTQKSRGKLVKLYVLGSVLAFFGVVLGLVETVCSPFTAASRLRDQEAAVA ELRDACEQQSLHKQALIAEGKTQEATLCSRALSLRQHAS hide sequence

Ensembl Acc Id:

ENSRNOP00000007879 ⟸ ENSRNOT00000007879

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M840-F1-model_v2	AlphaFold	Q5M840	1-103	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699128

Promoter ID:

EPDNEW_R9653

Type:

single initiation site

Name:

G0s2_1

Description:

G0/G1switch 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	112,005,091 - 112,005,151	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311675	AgrOrtholog
BioCyc Gene	G2FUF-16785	BioCyc
Ensembl Genes	ENSRNOG00000006019	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007879.5	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7369006	IMAGE-MGC_LOAD
InterPro	G0S2	UniProtKB/Swiss-Prot
KEGG Report	rno:289388	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109048	IMAGE-MGC_LOAD
NCBI Gene	289388	ENTREZGENE
PANTHER	G0/G1 SWITCH PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR15570	UniProtKB/Swiss-Prot
Pfam	G0-G1_switch_2	UniProtKB/Swiss-Prot
PhenoGen	G0s2	PhenoGen
PIRSF	G0/G1_switch_p2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006019	RatGTEx
UniProt	G0S2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-18	G0s2	G0/G1switch 2	G0s2	G0/G1 switch gene 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	G0s2	G0/G1 switch gene 2	G0s2_predicted	G0/G1 switch gene 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	G0s2_predicted	G0/G1 switch gene 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD