Advanced Search (OLGA)

Gene: Fam3b (FAM3 metabolism regulating signaling molecule B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fam3b

Name:

FAM3 metabolism regulating signaling molecule B

RGD ID:

1311662

Description:

Predicted to enable carbohydrate binding activity. Predicted to be involved in insulin secretion. Predicted to be located in membrane. Predicted to be active in extracellular space. Orthologous to human FAM3B (FAM3 metabolism regulating signaling molecule B); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 3,3',5,5'-tetrabromobisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cytokine-like protein 2-21; family with sequence similarity 3, member B; LOC304050; RGD1311662; similar to open reading frame 9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	50,300,926 - 50,333,296 (-)	NCBI		GRCr8
mRatBN7.2	11	36,831,532 - 36,863,902 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	36,831,532 - 36,869,713 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	45,480,008 - 45,512,453 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	38,151,386 - 38,183,828 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	37,311,313 - 37,343,761 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	37,922,308 - 37,993,279 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	37,922,292 - 37,993,207 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	41,429,763 - 41,503,454 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	37,470,404 - 37,505,705 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	37,528,141 - 37,558,745 (-)	NCBI
Celera	11	36,718,301 - 36,749,239 (-)	NCBI		Celera
Cytogenetic Map	11	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam3b	Rat	autistic disorder		ISO	FAM3B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Fam3b	Rat	Neurodevelopmental Disorders		ISO	FAM3B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam3b	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Fam3b (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of FAM3B mRNA	CTD	PMID:22206623
Fam3b	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Fam3b (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FAM3B mRNA	CTD	PMID:22206623
Fam3b	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Fam3b (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAM3B mRNA	CTD	PMID:17942748
Fam3b	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of FAM3B mRNA	CTD	PMID:26945725
Fam3b	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of FAM3B mRNA more ...	CTD	PMID:26496021 more ...
Fam3b	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FAM3B mRNA	CTD	PMID:32741896
Fam3b	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Fam3b (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAM3B mRNA	CTD	PMID:17942748
Fam3b	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Fam3b (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of FAM3B mRNA	CTD	PMID:21570461
Fam3b	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	EXP		6480464	tetrabromobisphenol A results in decreased expression of FAM3B mRNA	CTD	PMID:28300664
Fam3b	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	FAM3B (Homo sapiens)	6480464	bisphenol S results in decreased methylation of FAM3B gene	CTD	PMID:31601247
Fam3b	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of FAM3B mRNA	CTD	PMID:28959563
Fam3b	Rat	arsane	affects methylation	ISO	FAM3B (Homo sapiens)	6480464	Arsenic affects the methylation of FAM3B gene	CTD	PMID:25304211
Fam3b	Rat	arsenic atom	affects methylation	ISO	FAM3B (Homo sapiens)	6480464	Arsenic affects the methylation of FAM3B gene	CTD	PMID:25304211
Fam3b	Rat	azathioprine	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Azathioprine results in decreased expression of FAM3B mRNA	CTD	PMID:22623647
Fam3b	Rat	benzo[a]pyrene	increases expression	ISO	Fam3b (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of FAM3B mRNA	CTD	PMID:25908611
Fam3b	Rat	benzo[a]pyrene	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of FAM3B exon	CTD	PMID:27901495
Fam3b	Rat	benzo[a]pyrene	affects methylation	ISO	FAM3B (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of FAM3B promoter	CTD	PMID:27901495
Fam3b	Rat	benzo[a]pyrene	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of FAM3B mRNA	CTD	PMID:26238291
Fam3b	Rat	benzo[e]pyrene	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of FAM3B intron	CTD	PMID:30157460
Fam3b	Rat	beta-lapachone	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	beta-lapachone results in decreased expression of FAM3B mRNA	CTD	PMID:38218311
Fam3b	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of FAM3B mRNA	CTD	PMID:26496021
Fam3b	Rat	bisphenol A	affects expression	ISO	FAM3B (Homo sapiens)	6480464	bisphenol A affects the expression of FAM3B mRNA	CTD	PMID:30903817
Fam3b	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FAM3B mRNA	CTD	PMID:25181051 and PMID:36779543
Fam3b	Rat	buta-1,3-diene	increases expression	ISO	Fam3b (Mus musculus)	6480464	1 and 3-butadiene results in increased expression of FAM3B mRNA	CTD	PMID:29038090
Fam3b	Rat	cadmium dichloride	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of FAM3B mRNA	CTD	PMID:26472689
Fam3b	Rat	carbon nanotube	increases expression	ISO	Fam3b (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Fam3b	Rat	CGP 52608	multiple interactions	ISO	FAM3B (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to FAM3B gene]	CTD	PMID:28238834
Fam3b	Rat	chlordecone	increases expression	ISO	Fam3b (Mus musculus)	6480464	Chlordecone results in increased expression of FAM3B mRNA	CTD	PMID:33711761
Fam3b	Rat	chloroprene	decreases expression	EXP		6480464	Chloroprene results in decreased expression of FAM3B mRNA	CTD	PMID:23125180
Fam3b	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of FAM3B mRNA	CTD	PMID:30556269
Fam3b	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of FAM3B mRNA	CTD	PMID:30556269
Fam3b	Rat	copper(II) sulfate	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of FAM3B mRNA	CTD	PMID:19549813
Fam3b	Rat	cyclosporin A	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Cyclosporine results in decreased expression of FAM3B mRNA	CTD	PMID:25562108
Fam3b	Rat	delphinidin	decreases expression	ISO	Fam3b (Mus musculus)	6480464	delphinidin results in decreased expression of FAM3B mRNA	CTD	PMID:38291899
Fam3b	Rat	dicrotophos	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	dicrotophos results in decreased expression of FAM3B mRNA	CTD	PMID:28302478
Fam3b	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of FAM3B mRNA	CTD	PMID:25152437
Fam3b	Rat	dorsomorphin	multiple interactions	ISO	FAM3B (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FAM3B mRNA	CTD	PMID:27188386
Fam3b	Rat	entinostat	increases expression	ISO	FAM3B (Homo sapiens)	6480464	entinostat results in increased expression of FAM3B mRNA	CTD	PMID:26272509
Fam3b	Rat	entinostat	multiple interactions	ISO	FAM3B (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FAM3B mRNA	CTD	PMID:27188386
Fam3b	Rat	folic acid	multiple interactions	ISO	Fam3b (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FAM3B mRNA	CTD	PMID:22206623
Fam3b	Rat	fonofos	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	Fonofos results in increased methylation of FAM3B promoter	CTD	PMID:22847954
Fam3b	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of FAM3B mRNA	CTD	PMID:27387713
Fam3b	Rat	methapyrilene	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	Methapyrilene results in increased methylation of FAM3B intron	CTD	PMID:30157460
Fam3b	Rat	ozone	multiple interactions	ISO	Fam3b (Mus musculus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of FAM3B mRNA	CTD	PMID:27106289
Fam3b	Rat	ozone	decreases expression	ISO	Fam3b (Mus musculus)	6480464	Ozone results in decreased expression of FAM3B mRNA	CTD	PMID:33026818
Fam3b	Rat	paracetamol	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Acetaminophen results in decreased expression of FAM3B mRNA	CTD	PMID:26690555
Fam3b	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of FAM3B mRNA	CTD	PMID:32680482
Fam3b	Rat	parathion	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	Parathion results in increased methylation of FAM3B promoter	CTD	PMID:22847954
Fam3b	Rat	pirinixic acid	decreases expression	ISO	Fam3b (Mus musculus)	6480464	pirinixic acid results in decreased expression of FAM3B mRNA	CTD	PMID:17426115
Fam3b	Rat	quercetin	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Quercetin results in decreased expression of FAM3B mRNA	CTD	PMID:21632981
Fam3b	Rat	SB 431542	multiple interactions	ISO	FAM3B (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FAM3B mRNA	CTD	PMID:27188386
Fam3b	Rat	serpentine asbestos	increases expression	ISO	FAM3B (Homo sapiens)	6480464	Asbestos and Serpentine results in increased expression of FAM3B mRNA	CTD	PMID:33581214
Fam3b	Rat	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide results in increased expression of FAM3B mRNA	CTD	PMID:22431001
Fam3b	Rat	terbufos	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	terbufos results in increased methylation of FAM3B promoter	CTD	PMID:22847954
Fam3b	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FAM3B mRNA	CTD	PMID:32741896
Fam3b	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of FAM3B mRNA	CTD	PMID:30012374
Fam3b	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FAM3B mRNA	CTD	PMID:33387578
Fam3b	Rat	urethane	decreases expression	ISO	FAM3B (Homo sapiens)	6480464	Urethane results in decreased expression of FAM3B mRNA	CTD	PMID:28818685
Fam3b	Rat	valproic acid	affects expression	ISO	Fam3b (Mus musculus)	6480464	Valproic Acid affects the expression of FAM3B mRNA	CTD	PMID:17292431
Fam3b	Rat	valproic acid	increases methylation	ISO	FAM3B (Homo sapiens)	6480464	Valproic Acid results in increased methylation of FAM3B gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam3b	Rat	insulin secretion	involved_in	ISO	Fam3b (Mus musculus)	1624291	PMID:12160727	RGD	PMID:12160727
Fam3b	Rat	insulin secretion	involved_in	IBA	MGI:1270150 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fam3b	Rat	insulin secretion	involved_in	ISO	FAM3B (Homo sapiens)	1624291	PMID:12160727	RGD	PMID:12160727

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam3b	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fam3b	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fam3b	Rat	extracellular space	is_active_in	IBA	MGI:1201784 and PANTHER:PTN000378191	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fam3b	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam3b	Rat	carbohydrate binding	enables	IEA	UniRule:UR001922981	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Fam3b	Rat	carbohydrate binding	enables	IEA	UniProtKB-KW:KW-0430	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fam3b	Rat	protein binding	enables	ISO	FAM3B (Homo sapiens)	1624291	UniProtKB:P02545 more ...	RGD	PMID:32296183 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12160727	PMID:19199708	PMID:23376485	PMID:28536423

Fam3b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	50,300,926 - 50,333,296 (-)	NCBI		GRCr8
mRatBN7.2	11	36,831,532 - 36,863,902 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	36,831,532 - 36,869,713 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	45,480,008 - 45,512,453 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	38,151,386 - 38,183,828 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	37,311,313 - 37,343,761 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	37,922,308 - 37,993,279 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	37,922,292 - 37,993,207 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	41,429,763 - 41,503,454 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	37,470,404 - 37,505,705 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	37,528,141 - 37,558,745 (-)	NCBI
Celera	11	36,718,301 - 36,749,239 (-)	NCBI		Celera
Cytogenetic Map	11	q12	NCBI

FAM3B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	41,304,242 - 41,357,727 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	41,304,212 - 41,357,727 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	42,688,728 - 42,729,654 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	41,610,531 - 41,651,524 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	21	27,886,894 - 27,927,901 (+)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	28,157,559 - 28,198,557 (+)	NCBI		HuRef
CHM1_1	21	42,249,456 - 42,290,457 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	21	39,692,606 - 39,746,338 (+)	NCBI		T2T-CHM13v2.0

Fam3b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	97,272,165 - 97,306,136 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	97,272,165 - 97,316,016 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	97,470,965 - 97,504,936 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	97,470,965 - 97,514,816 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	97,692,693 - 97,726,543 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	97,575,996 - 97,659,852 (-)	NCBI		MGSCv36	mm8
Celera	16	98,531,405 - 98,565,114 (-)	NCBI		Celera
Cytogenetic Map	16	C4	NCBI
cM Map	16	57.47	NCBI

Fam3b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	40,914,239 - 40,932,177 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	40,914,408 - 40,939,850 (-)	NCBI	ChiLan1.0	ChiLan1.0

FAM3B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	37,396,847 - 37,438,869 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	32,251,107 - 32,293,169 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	27,650,185 - 27,692,249 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	40,979,149 - 41,020,089 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	40,979,149 - 41,020,089 (+)	Ensembl	panpan1.1		panPan2

FAM3B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	35,805,981 - 35,844,258 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	35,806,217 - 35,844,263 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	34,961,227 - 34,999,135 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	35,323,709 - 35,361,728 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	35,323,758 - 35,361,733 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	35,219,538 - 35,257,553 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	35,197,593 - 35,235,594 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	35,691,726 - 35,729,740 (+)	NCBI		UU_Cfam_GSD_1.0

Fam3b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	35,149,735 - 35,178,093 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	2,289,687 - 2,318,977 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	2,289,795 - 2,317,616 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM3B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	204,752,196 - 204,796,777 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	204,746,338 - 204,796,792 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	215,061,989 - 215,072,431 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM3B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	85,211,126 - 85,277,034 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	85,223,553 - 85,277,839 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	13,075,832 - 13,129,760 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam3b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	28,639,087 - 28,659,627 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	28,638,914 - 28,658,930 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fam3b
114 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	35
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000002683
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat

RH134651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	36,830,892 - 36,831,112 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	37,922,375 - 37,922,594	NCBI	Rnor6.0
Rnor_5.0	11	41,429,830 - 41,430,049	UniSTS	Rnor5.0
RGSC_v3.4	11	37,469,764 - 37,469,983	UniSTS	RGSC3.4
Celera	11	36,717,660 - 36,717,879	UniSTS
RH 3.4 Map	11	268.8	UniSTS
Cytogenetic Map	11	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	45	104	88	88	57	25	57	6	211	92	84	45	58	31


RefSeq Transcripts	NM_001107102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006248157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002683 ⟹ ENSRNOP00000002683

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	36,831,532 - 36,863,902 (-)	Ensembl
Rnor_6.0 Ensembl	11	37,923,015 - 37,993,207 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077050 ⟹ ENSRNOP00000067982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	36,831,532 - 36,869,713 (-)	Ensembl
Rnor_6.0 Ensembl	11	37,922,308 - 37,993,204 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091614 ⟹ ENSRNOP00000075388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	36,831,532 - 36,863,806 (-)	Ensembl
Rnor_6.0 Ensembl	11	37,922,292 - 37,993,207 (-)	Ensembl

RefSeq Acc Id:

NM_001107102 ⟹ NP_001100572

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	50,300,926 - 50,333,296 (-)	NCBI
mRatBN7.2	11	36,831,532 - 36,863,902 (-)	NCBI
Rnor_6.0	11	37,923,015 - 37,993,207 (-)	NCBI
Rnor_5.0	11	41,429,763 - 41,503,454 (-)	NCBI
RGSC_v3.4	11	37,470,404 - 37,505,705 (-)	RGD
Celera	11	36,718,301 - 36,749,239 (-)	RGD

Sequence:

show sequence

CCCATTCTATGTGCAGCTCAGGCAGGTTGGCCAGCTAATACAGGTCCCTGAGAATTACAGCCGGGAGCTGGGTAGGAAGAAAGCAGTTTCTGGAAGATGCGTCCAGTTACAGCAGGTATCTTCAAGGC
ACTACTGTTTATTTTCTCCTCCCTGTGCGCCTGGTATTCTGGGTACCTGCTCGCGGAGCTCATTCCTGACGTGCCCCTGTCCAACACTCTCTACAACATCCGAAGCATTGGGGAGAGACCTGTTCTCA
AAGCCCCAGTCCCCAAAAGACAAAAATGTGACCATTGGTCCCCATGTCCTCCTGACACCTATGCCTACCGGCTGCTCAGTGGTGGTGGCCTAGACAAGTATGCCAAGATCTGCTTTGAGGATGAAATG
CTATTAGGAGAGAAGACGGGGAATGTGGCAAGAGGGATAAACATCGCTGTTGTTGACTATGAGACGGGGAAAGTAATATCAACAAAGTACTTTGACATGTACGAAGGTGATAACTCTGAGCCAATGAC
TAAGTTTATTCAGAGCATCCCTTCGAAATCCCTGCTGTTCATGGTGACTCATGATGACGGAAGCCACAAACTGCAGGCTCAAGCAAAGGATGCCATAGAAGCCCTTGGAAGCAAAGAAATCAAGAACA
TAAAGTTCAGATCAAGCTGGGTGTTTGTTGCAGCAAAGGGCTTTGTGCTCCCTTCAGAAAGGAGAGAGAAAAAATCAACCACTCAGATCAATCCAGGAACAGATACTCCGGCTGGCCAGCAGAGATCC
AGATCGAAGGATGCATACCCAAAGGGCTGAGATAACGGCGCTTGCACCTCAGTAGACCTGTTTCGTACAGATACGCTCAGCTGGAACATCACAGGATTCTGTTCCTTCGAGTCCAGCTGTGAAGGAAA
GGGCTGATGTGGATTTGCAGTTTGTTGTAAACAATAAGACATTGTTGGTGACACTG

hide sequence


Protein RefSeqs	NP_001100572	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM10968	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002683
	ENSRNOP00000002683.6
	ENSRNOP00000067982.2
	ENSRNOP00000075388.2

RefSeq Acc Id:

NP_001100572 ⟸ NM_001107102

- UniProtKB:

D4A1V2 (UniProtKB/TrEMBL), A0A096MJ41 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRPVTAGIFKALLFIFSSLCAWYSGYLLAELIPDVPLSNTLYNIRSIGERPVLKAPVPKRQKCDHWSPCPPDTYAYRLLSGGGLDKYAKICFEDEMLLGEKTGNVARGINIAVVDYETGKVISTKYFD
MYEGDNSEPMTKFIQSIPSKSLLFMVTHDDGSHKLQAQAKDAIEALGSKEIKNIKFRSSWVFVAAKGFVLPSERREKKSTTQINPGTDTPAGQQRSRSKDAYPKG

hide sequence

Ensembl Acc Id:

ENSRNOP00000067982 ⟸ ENSRNOT00000077050

Ensembl Acc Id:

ENSRNOP00000002683 ⟸ ENSRNOT00000002683

Ensembl Acc Id:

ENSRNOP00000075388 ⟸ ENSRNOT00000091614

Protein Domains

ILEI/PANDER

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A096MJ41-F1-model_v2	AlphaFold	A0A096MJ41	1-235	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698099

Promoter ID:

EPDNEW_R8617

Type:

initiation region

Name:

Fam3b_1

Description:

family with sequence similarity 3, member B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	37,993,188 - 37,993,248	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-21684	BioCyc
Ensembl Genes	ENSRNOG00000001962	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002683	ENTREZGENE
	ENSRNOT00000002683.7	UniProtKB/TrEMBL
	ENSRNOT00000077050.3	UniProtKB/TrEMBL
	ENSRNOT00000091614.2	UniProtKB/TrEMBL
InterPro	FAM3	UniProtKB/TrEMBL
	ILEI/PANDER_dom	UniProtKB/TrEMBL
KEGG Report	rno:304050	UniProtKB/TrEMBL
NCBI Gene	304050	ENTREZGENE
PANTHER	PTHR14592	UniProtKB/TrEMBL
Pfam	ILEI	UniProtKB/TrEMBL
PhenoGen	Fam3b	PhenoGen
PROSITE	GG_LECTIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001962	RatGTEx
UniProt	A0A096MJ41	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2KAG4_RAT	UniProtKB/TrEMBL
	A6IQG5_RAT	UniProtKB/TrEMBL
	D4A1V2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-30	Fam3b	FAM3 metabolism regulating signaling molecule B	Fam3b	family with sequence similarity 3, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-10-22	Fam3b	family with sequence similarity 3, member B	FAM3B	family with sequence similarity 3, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	FAM3B	family with sequence similarity 3, member B	RGD1311662_predicted	similar to open reading frame 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	RGD1311662_predicted	similar to open reading frame 9	Fam3b_predicted	family with sequence similarity 3, member B (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-12	Fam3b_predicted	family with sequence similarity 3, member B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar