Advanced Search (OLGA)

Gene: Mogat1 (monoacylglycerol O-acyltransferase 1) Rattus norvegicus

Analyze

Symbol:

Mogat1

Name:

monoacylglycerol O-acyltransferase 1

RGD ID:

1311644

Description:

Predicted to enable 2-acylglycerol O-acyltransferase activity and diacylglycerol O-acyltransferase activity. Predicted to be involved in diacylglycerol biosynthetic process and triglyceride biosynthetic process. Predicted to be located in endoplasmic reticulum and membrane. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human MOGAT1 (monoacylglycerol O-acyltransferase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-acylglycerol O-acyltransferase 1; LOC363261

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	HGNC	Ensembl, NCBI, OrthoMCL
Mus musculus (house mouse):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FTH1 (ferritin heavy chain 1)	HGNC	OMA
Homo sapiens (human):	TMEM126B (transmembrane protein 126B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MOGAT1 (monoacylglycerol O-acyltransferase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mogat1 (monoacylglycerol O-acyltransferase 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1941	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1941	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DGA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DGA1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K07B1.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K07B1.4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y53G8B.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	Y53G8B.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dgat-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	dgtr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dgtr-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1946	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1946	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dgat2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dgat2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mogat1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mogat1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	87,429,427 - 87,436,977 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	87,405,119 - 87,436,977 (+)	Ensembl				GRCr8
mRatBN7.2	9	79,980,963 - 79,988,513 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	79,956,649 - 79,988,513 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	88,410,738 - 88,418,288 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	93,524,754 - 93,532,302 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	91,922,170 - 91,929,720 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	84,405,481 - 84,418,657 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	84,405,477 - 84,418,591 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	84,170,150 - 84,177,700 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	77,901,139 - 77,908,689 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	77,488,393 - 77,495,943 (+)	NCBI		Celera
RGSC_v3.1	9	78,083,037 - 78,092,100 (+)	NCBI
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (EXP)

choline (ISO)

ciglitazone (ISO)

ciguatoxin CTX1B (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dichloroacetic acid (ISO)

epoxiconazole (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

indometacin (ISO)

inulin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methoxyacetic acid (EXP)

methylmercury chloride (EXP)

Monobutylphthalate (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

penconazole (ISO)

perflubutane (ISO)

perfluorobutanesulfonic acid (ISO)

perfluorodecanoic acid (ISO)

perfluoroheptanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorohexanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

progesterone (ISO)

quercetin (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (ISO)

testosterone (ISO)

titanium dioxide (ISO)

trichloroethene (EXP,ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

diacylglycerol biosynthetic process (IBA,ISO)

glycerol metabolic process (IEA)

lipid metabolic process (IEA)

triglyceride biosynthetic process (IBA)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IBA,IEA)

membrane (ISO)

Molecular Function

2-acylglycerol O-acyltransferase activity (IEA,ISO)

acyltransferase activity (IEA)

diacylglycerol O-acyltransferase activity (IBA,ISO)

O-acyltransferase activity (IEA)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12077311

Genomics

Comparative Map Data

Mogat1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	87,429,427 - 87,436,977 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	87,405,119 - 87,436,977 (+)	Ensembl				GRCr8
mRatBN7.2	9	79,980,963 - 79,988,513 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	79,956,649 - 79,988,513 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	88,410,738 - 88,418,288 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	93,524,754 - 93,532,302 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	91,922,170 - 91,929,720 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	84,405,481 - 84,418,657 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	84,405,477 - 84,418,591 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	84,170,150 - 84,177,700 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	77,901,139 - 77,908,689 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	77,488,393 - 77,495,943 (+)	NCBI		Celera
RGSC_v3.1	9	78,083,037 - 78,092,100 (+)	NCBI
Cytogenetic Map	9	q33	NCBI

MOGAT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	222,671,658 - 222,709,930 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	222,671,658 - 222,709,930 (+)	Ensembl			hg38	GRCh38
GRCh37	2	223,536,377 - 223,574,649 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	223,244,701 - 223,282,893 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	223,361,961 - 223,400,154	NCBI
Celera	2	217,304,367 - 217,342,566 (+)	NCBI		Celera
Cytogenetic Map	2	q36.1	NCBI
HuRef	2	215,389,777 - 215,428,017 (+)	NCBI		HuRef
CHM1_1	2	223,542,837 - 223,581,032 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	223,156,723 - 223,195,041 (+)	NCBI		T2T-CHM13v2.0

Mogat1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	78,487,697 - 78,597,882 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	78,487,628 - 78,514,810 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	78,511,060 - 78,606,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	78,510,991 - 78,538,173 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	78,507,635 - 78,534,748 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	78,395,038 - 78,421,317 (+)	NCBI		MGSCv36	mm8
Celera	1	78,995,617 - 79,006,206 (+)	NCBI		Celera
Cytogenetic Map	1	C4	NCBI
cM Map	1	40.59	NCBI

Mogat1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	11,125,149 - 11,147,060 (-)	Ensembl
ChiLan1.0	NW_004955453	11,125,494 - 11,159,690 (-)	NCBI	ChiLan1.0	ChiLan1.0

MOGAT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	125,285,809 - 125,324,165 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	125,300,776 - 125,341,238 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	109,912,603 - 109,951,322 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	228,493,571 - 228,531,660 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	228,493,571 - 228,531,678 (+)	Ensembl			panPan2	panpan1.1

MOGAT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	28,730,454 - 28,767,740 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	28,730,010 - 28,767,569 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	29,567,024 - 29,604,193 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	28,756,069 - 28,793,214 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	28,755,958 - 28,788,035 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	28,666,374 - 28,703,654 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	28,598,447 - 28,635,746 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	28,617,008 - 28,654,194 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mogat1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	178,283,196 - 178,318,842 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	4,625,867 - 4,662,861 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936569	4,625,981 - 4,665,930 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MOGAT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	124,568,435 - 124,607,929 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	124,568,449 - 124,607,925 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	138,074,682 - 138,110,191 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MOGAT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	108,594,492 - 108,637,370 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	108,594,534 - 108,636,948 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	90,737,581 - 90,804,317 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mogat1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624823	2,532,856 - 2,559,815 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mogat1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	151,708,179 - 151,734,106 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mogat1
28 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	125
Count of miRNA genes:	109
Interacting mature miRNAs:	113
Transcripts:	ENSRNOT00000019724, ENSRNOT00000050456
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56047863	101047863	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	63376862	108376862	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	65657365	108376720	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	86720043	110356905	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	44458256	99506504	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	86720043	121768150	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	64220169	109220169	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	86722132	92642305	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	64220169	109220169	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	64220169	109220169	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	85262459	109044727	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	85262459	118999486	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	48718864	108376862	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	64220169	109220169	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	54506504	99506504	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	59	126	87	86	56	34	56	6	258	119	4	112	60	82	30	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001438552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001839667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019724 ⟹ ENSRNOP00000019724

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	87,429,427 - 87,436,977 (+)	Ensembl
mRatBN7.2 Ensembl	9	79,980,963 - 79,988,513 (+)	Ensembl
Rnor_6.0 Ensembl	9	84,410,972 - 84,418,522 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082378 ⟹ ENSRNOP00000074410

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	87,405,119 - 87,436,962 (+)	Ensembl
mRatBN7.2 Ensembl	9	79,956,649 - 79,988,505 (+)	Ensembl
Rnor_6.0 Ensembl	9	84,405,477 - 84,418,591 (+)	Ensembl

RefSeq Acc Id:

NM_001108803 ⟹ NP_001102273

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,429,427 - 87,436,977 (+)	NCBI
mRatBN7.2	9	79,980,963 - 79,988,513 (+)	NCBI
Rnor_6.0	9	84,410,972 - 84,418,522 (+)	NCBI
Rnor_5.0	9	84,170,150 - 84,177,700 (+)	NCBI
RGSC_v3.4	9	77,901,139 - 77,908,689 (+)	RGD
Celera	9	77,488,393 - 77,495,943 (+)	RGD

Sequence:

show sequence

TTGACTCACTAAGGGCCAGTTTCAGTTTCTAAGAGGAGTTTGTCTCATGTGATGAGCAAGGAAG
GAGGTGGGAACATCTCAGTCATTGTCATCGGGGGTGCGAAAGAGCTACTGGAGTCCTTCCCTGG
AAGATATTCTCTGTGCCTTCTTCAGCGCAAAGGATTTGTTAAGATCGCCTTGACCCATGGTGCC
CATTTGGTTCCAGTGTTTTCTTTTGGTGAAAATGAACTATATAGCCAAGTCGACAACCCTAAAG
GCTCATGGCTTCGGACTGCCCAAGACAAAGTGTATAACCTAACGGGGTTGGCCTTGCCACTATT
CTATGCCAGAGGAATTTTCCAGAACAGCTTTGGCCTAATGCCCTATCGGAAATTGATCTACACT
GTTGCTGCGGTTGGCACAGCAGCTCGTTTGACTCAGAAGTCAAACCATCAGAACGACAGCTCAG
TGTCTGCTGAGAAGGGAAACTCTTTTATTTGTTGTCAAGTGGGATGGTGTGACCGAGATAGGCA
GCCATTGGCCGCCCCATCCCTGTTCAGAAGACTCTGCACCCGACCCCAGAGCAGATTGATGAGC
TGCATCAGACGTACATGGAGGAGCTAAGGAAACTCTTCAATGAACATAAAGGGAAATACGGTAT
TCCGGAGCATGAAACTCTGGTTTTTAAATAACCGTCTTCCTCCAAGCCATACTGAAGGAAGACA
AGAAAACATTGTTGAGAAAATAAATATTTTAAATAACTTCTCTGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102273	(Get FASTA)	NCBI Sequence Viewer
	NP_001425481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75471	(Get FASTA)	NCBI Sequence Viewer
	EDL75472	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019724
	ENSRNOP00000019724.4
	ENSRNOP00000074410.2

RefSeq Acc Id:	NP_001102273 ⟸ NM_001108803
- UniProtKB:	D4A6J3 (UniProtKB/TrEMBL), A6JW64 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSKEGGGNISVIVIGGAKELLESFPGRYSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQV DNPKGSWLRTAQDKVYNLTGLALPLFYARGIFQNSFGLMPYRKLIYTVAAVGTAARLTQKSNHQ NDSSVSAEKGNSFICCQVGWCDRDRQPLAAPSLFRRLCTRPQSRLMSCIRRTWRS hide sequence

Ensembl Acc Id:

ENSRNOP00000074410 ⟸ ENSRNOT00000082378

Ensembl Acc Id:

ENSRNOP00000019724 ⟸ ENSRNOT00000019724

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K7Z7-F1-model_v2	AlphaFold	A0A0G2K7Z7	1-297	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311644	AgrOrtholog
BioCyc Gene	G2FUF-27023	BioCyc
BioCyc Pathway	PWY-7420 [monoacylglycerol metabolism (yeast)]	BioCyc
BioCyc Pathway Image	PWY-7420	BioCyc
Ensembl Genes	ENSRNOG00000014692	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019724	ENTREZGENE
	ENSRNOT00000019724.6	UniProtKB/TrEMBL
	ENSRNOT00000082378.3	UniProtKB/TrEMBL
InterPro	DAGAT	UniProtKB/TrEMBL
KEGG Report	rno:363261	UniProtKB/TrEMBL
NCBI Gene	363261	ENTREZGENE
PANTHER	2-ACYLGLYCEROL O-ACYLTRANSFERASE 1	UniProtKB/TrEMBL
	DIACYLGLYCEROL O-ACYLTRANSFERASE	UniProtKB/TrEMBL
Pfam	DAGAT	UniProtKB/TrEMBL
PhenoGen	Mogat1	PhenoGen
RatGTEx	ENSRNOG00000014692	RatGTEx
UniProt	A0A0G2K7Z7	ENTREZGENE, UniProtKB/TrEMBL
	A6JW64	ENTREZGENE, UniProtKB/TrEMBL
	D4A6J3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mogat1	monoacylglycerol O-acyltransferase 1	Mogat1_predicted	monoacylglycerol O-acyltransferase 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mogat1_predicted	monoacylglycerol O-acyltransferase 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

BioCyc Pathways