Symbol:
Hsph1
Name:
heat shock protein family H (Hsp110) member 1
RGD ID:
1311609
Description:
Predicted to enable adenyl-nucleotide exchange factor activity and alpha-tubulin binding activity. Predicted to be involved in protein folding. Predicted to act upstream of or within chaperone cofactor-dependent protein refolding. Predicted to be located in cytoplasm; microtubule; and nucleoplasm. Predicted to be part of protein-containing complex. Predicted to be active in cytosol and nucleus. Orthologous to human HSPH1 (heat shock protein family H (Hsp110) member 1); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
heat shock 105/110 protein 1; heat shock 105kDa; heat shock 105kDa/110kDa protein 1; heat shock 110 kDa protein; heat shock protein 105; heat shock protein 105 kDa; Hsp105; LOC288444
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 10,427,368 - 10,446,602 (+) NCBI GRCr8 mRatBN7.2 12 5,390,916 - 5,410,224 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 5,390,922 - 5,410,224 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 6,069,228 - 6,088,216 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 6,692,653 - 6,711,641 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 5,720,173 - 5,739,161 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 6,322,685 - 6,341,898 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 6,322,668 - 6,341,902 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 8,423,546 - 8,442,481 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 5,794,645 - 5,811,453 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 5,794,644 - 5,811,451 (+) NCBI Celera 12 7,162,640 - 7,181,902 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hsph1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HSPH1 mRNA] CTD PMID:31150632 Hsph1 Rat (1->4)-beta-D-glucan multiple interactions ISO Hsph1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HSPH1 mRNA CTD PMID:36331819 Hsph1 Rat (2,4,5-trichlorophenoxy)acetic acid decreases expression ISO Hsph1 (Mus musculus) 6480464 2 more ... CTD PMID:18579281 Hsph1 Rat (E)-cinnamyl alcohol increases expression ISO HSPH1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat (S)-amphetamine increases expression ISO Hsph1 (Mus musculus) 6480464 Dextroamphetamine results in increased expression of HSPH1 mRNA CTD PMID:12205029 and PMID:12558987 Hsph1 Rat (S)-amphetamine multiple interactions ISO Hsph1 (Mus musculus) 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in increased expression of HSPH1 mRNA] CTD PMID:12205029 Hsph1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of HSPH1 mRNA CTD PMID:24096037 Hsph1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Hsph1 (Mus musculus) 6480464 o and p'-DDT results in increased expression of HSPH1 mRNA CTD PMID:24096037 Hsph1 Rat 1,2-dimethylhydrazine increases expression ISO Hsph1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HSPH1 mRNA CTD PMID:22206623 Hsph1 Rat 1,2-dimethylhydrazine multiple interactions ISO Hsph1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HSPH1 mRNA] CTD PMID:22206623 Hsph1 Rat 1,4-phenylenediamine increases expression ISO HSPH1 (Homo sapiens) 6480464 4-phenylenediamine results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO HSPH1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to HSPH1 protein CTD PMID:32991956 Hsph1 Rat 1-fluoro-2,4-dinitrobenzene increases expression ISO HSPH1 (Homo sapiens) 6480464 Dinitrofluorobenzene results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of HSPH1 mRNA CTD PMID:20551477 Hsph1 Rat 1-naphthyl isothiocyanate multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of HSPH1 mRNA CTD PMID:27344345 Hsph1 Rat 17alpha-ethynylestradiol increases expression ISO Hsph1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HSPH1 mRNA CTD PMID:17942748 and PMID:24096037 Hsph1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HSPH1 mRNA CTD PMID:24096037 Hsph1 Rat 17alpha-ethynylestradiol multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Ethinyl Estradiol co-treated with Cholic Acids] affects the expression of HSPH1 mRNA CTD PMID:27344345 Hsph1 Rat 17alpha-ethynylestradiol multiple interactions ISO Hsph1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPH1 mRNA CTD PMID:17942748 Hsph1 Rat 17alpha-ethynylestradiol affects expression ISO Hsph1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of HSPH1 mRNA CTD PMID:17555576 Hsph1 Rat 17beta-estradiol increases expression ISO HSPH1 (Homo sapiens) 6480464 Estradiol results in increased expression of HSPH1 mRNA CTD PMID:20106945 and PMID:31614463 Hsph1 Rat 17beta-estradiol increases expression ISO Hsph1 (Mus musculus) 6480464 Estradiol results in increased expression of HSPH1 mRNA CTD PMID:14664709 and PMID:39298647 Hsph1 Rat 17beta-estradiol multiple interactions ISO HSPH1 (Homo sapiens) 6480464 Estradiol promotes the reaction [HSF protein binds to HSPH1 promoter] CTD PMID:31614463 Hsph1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HSPH1 mRNA CTD PMID:32145629 Hsph1 Rat 1H-pyrazole increases expression ISO Hsph1 (Mus musculus) 6480464 pyrazole results in increased expression of HSPH1 mRNA CTD PMID:17945193 Hsph1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO HSPH1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hsph1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPH1 mRNA CTD PMID:15034205 more ... Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HSPH1 mRNA CTD PMID:34747641 Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO HSPH1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of HSPH1 mRNA CTD PMID:22298810 Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPH1 mRNA CTD PMID:16960034 and PMID:33387578 Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hsph1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPH1 mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of HSPH1 mRNA] CTD PMID:15034205 and PMID:17942748 Hsph1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO HSPH1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HSPH1 mRNA CTD PMID:15056799 Hsph1 Rat 2,4,6-tribromophenol decreases expression ISO HSPH1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hsph1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HSPH1 mRNA CTD PMID:21346803 Hsph1 Rat 2,6-dimethoxyphenol multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Hsph1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of HSPH1 mRNA CTD PMID:21346803 Hsph1 Rat 2-bromohexadecanoic acid multiple interactions ISO HSPH1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HSPH1 protein] CTD PMID:38195004 Hsph1 Rat 2-hydroxypropanoic acid increases expression ISO HSPH1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of HSPH1 mRNA CTD PMID:23999411 and PMID:30851411 Hsph1 Rat 2-methylcholine affects expression ISO HSPH1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of HSPH1 mRNA CTD PMID:21179406 Hsph1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of HSPH1 mRNA CTD PMID:15890375 Hsph1 Rat 2-palmitoylglycerol increases expression ISO HSPH1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of HSPH1 mRNA CTD PMID:37199045 Hsph1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Hsph1 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of HSPH1 mRNA CTD PMID:25172293 Hsph1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO HSPH1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of HSPH1 protein CTD PMID:31675489 Hsph1 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Hsph1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of HSPH1 promoter CTD PMID:26251327 Hsph1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Hsph1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of HSPH1 mRNA CTD PMID:26251327 Hsph1 Rat 3-phenylprop-2-enal increases expression ISO HSPH1 (Homo sapiens) 6480464 cinnamaldehyde results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat 4,4'-sulfonyldiphenol increases expression ISO Hsph1 (Mus musculus) 6480464 bisphenol S results in increased expression of HSPH1 mRNA CTD PMID:37611474 and PMID:39298647 Hsph1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of HSPH1 mRNA CTD PMID:15890375 Hsph1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of HSPH1 mRNA CTD PMID:21346803 Hsph1 Rat 4-hydroxynon-2-enal increases expression ISO Hsph1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of HSPH1 mRNA CTD PMID:19191707 Hsph1 Rat 4-phenylbutyric acid increases expression ISO HSPH1 (Homo sapiens) 6480464 4-phenylbutyric acid results in increased expression of HSPH1 mRNA CTD PMID:14583596 Hsph1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HSPH1 mRNA CTD PMID:24780913 Hsph1 Rat 8-Br-cAMP increases expression ISO HSPH1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of HSPH1 mRNA CTD PMID:22079614 Hsph1 Rat 9-cis-retinoic acid decreases expression EXP 6480464 Alitretinoin results in decreased expression of HSPH1 mRNA CTD PMID:16648578 Hsph1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of HSPH1 mRNA CTD PMID:31881176 Hsph1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HSPH1 mRNA CTD PMID:28959563 Hsph1 Rat acrylamide increases expression ISO HSPH1 (Homo sapiens) 6480464 Acrylamide results in increased expression of HSPH1 mRNA CTD PMID:32763439 Hsph1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of HSPH1 mRNA CTD PMID:15890375 and PMID:33354967 Hsph1 Rat aflatoxin B1 decreases methylation ISO HSPH1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of HSPH1 gene CTD PMID:27153756 Hsph1 Rat albendazole multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSPH1 mRNA CTD PMID:16861626 Hsph1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of HSPH1 mRNA CTD PMID:24977338 Hsph1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HSPH1 mRNA CTD PMID:20488242 Hsph1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of HSPH1 mRNA CTD PMID:38685447 Hsph1 Rat amphibole asbestos increases expression ISO HSPH1 (Homo sapiens) 6480464 Asbestos and Amphibole results in increased expression of HSPH1 protein CTD PMID:20855422 Hsph1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of HSPH1 protein CTD PMID:21791222 Hsph1 Rat Aroclor 1254 decreases expression ISO Hsph1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HSPH1 mRNA CTD PMID:23650126 Hsph1 Rat arsane increases methylation ISO HSPH1 (Homo sapiens) 6480464 Arsenic results in increased methylation of HSPH1 gene CTD PMID:38030093 Hsph1 Rat arsane multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA more ... CTD PMID:35809665 and PMID:39836092 Hsph1 Rat arsane decreases expression ISO Hsph1 (Mus musculus) 6480464 Arsenic results in decreased expression of HSPH1 mRNA CTD PMID:19654921 Hsph1 Rat arsenic atom increases methylation ISO HSPH1 (Homo sapiens) 6480464 Arsenic results in increased methylation of HSPH1 gene CTD PMID:38030093 Hsph1 Rat arsenic atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA more ... CTD PMID:35809665 and PMID:39836092 Hsph1 Rat arsenic atom decreases expression ISO Hsph1 (Mus musculus) 6480464 Arsenic results in decreased expression of HSPH1 mRNA CTD PMID:19654921 Hsph1 Rat arsenic trichloride multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in increased expression of HSPH1 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of HSPH1 mRNA CTD PMID:35809665 Hsph1 Rat arsenous acid increases expression ISO HSPH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HSPH1 mRNA CTD PMID:17530438 more ... Hsph1 Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of HSPH1 mRNA CTD PMID:20221588 Hsph1 Rat atrazine decreases expression ISO HSPH1 (Homo sapiens) 6480464 Atrazine results in decreased expression of HSPH1 mRNA CTD PMID:22378314 Hsph1 Rat Aurin increases expression ISO HSPH1 (Homo sapiens) 6480464 aurin results in increased expression of HSPH1 mRNA CTD PMID:25477506 Hsph1 Rat benzo[a]pyrene multiple interactions ISO Hsph1 (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of HSPH1 mRNA] CTD PMID:15034205 Hsph1 Rat benzo[a]pyrene increases expression ISO HSPH1 (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in increased expression of HSPH1 mRNA CTD PMID:24356939 Hsph1 Rat benzo[a]pyrene increases expression ISO Hsph1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HSPH1 mRNA CTD PMID:15034205 more ... Hsph1 Rat Benzo[ghi]perylene decreases expression ISO Hsph1 (Mus musculus) 6480464 1 and 12-benzoperylene results in decreased expression of HSPH1 mRNA CTD PMID:26377693 Hsph1 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of HSPH1 mRNA CTD PMID:16648578 Hsph1 Rat bis(2-ethylhexyl) phthalate affects expression ISO Hsph1 (Mus musculus) 6480464 Diethylhexyl Phthalate affects the expression of HSPH1 mRNA CTD PMID:21318169 Hsph1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HSPH1 mRNA CTD PMID:21318169 and PMID:33789034 Hsph1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of HSPH1 mRNA CTD PMID:26496021 Hsph1 Rat bisphenol A decreases expression ISO HSPH1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HSPH1 protein CTD PMID:31675489 and PMID:37567409 Hsph1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HSPH1 mRNA CTD PMID:32145629 Hsph1 Rat bisphenol A affects expression ISO HSPH1 (Homo sapiens) 6480464 bisphenol A affects the expression of HSPH1 mRNA CTD PMID:30903817 Hsph1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HSPH1 mRNA CTD PMID:30903817 Hsph1 Rat bisphenol A decreases methylation ISO Hsph1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of HSPH1 promoter CTD PMID:27312807 Hsph1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HSPH1 mRNA CTD PMID:25181051 more ... Hsph1 Rat bisphenol AF increases expression ISO HSPH1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of HSPH1 protein CTD PMID:34186270 Hsph1 Rat bisphenol F increases expression ISO Hsph1 (Mus musculus) 6480464 bisphenol F results in increased expression of HSPH1 mRNA CTD PMID:38685157 Hsph1 Rat bisphenol F increases expression ISO HSPH1 (Homo sapiens) 6480464 bisphenol F results in increased expression of HSPH1 protein CTD PMID:34186270 Hsph1 Rat bleomycin A5 decreases expression ISO HSPH1 (Homo sapiens) 6480464 bleomycetin results in decreased expression of HSPH1 mRNA CTD PMID:21040473 Hsph1 Rat bortezomib increases expression ISO HSPH1 (Homo sapiens) 6480464 Bortezomib results in increased expression of HSPH1 mRNA CTD PMID:17898295 Hsph1 Rat cadmium atom increases expression ISO HSPH1 (Homo sapiens) 6480464 Cadmium results in increased expression of HSPH1 mRNA CTD PMID:21120746 and PMID:24284285 Hsph1 Rat cadmium atom multiple interactions ISO Hsph1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HSPH1 mRNA CTD PMID:37325564 Hsph1 Rat cadmium atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HSPH1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HSPH1 protein CTD PMID:38195004 Hsph1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of HSPH1 promoter CTD PMID:22457795 Hsph1 Rat cadmium dichloride multiple interactions ISO Hsph1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HSPH1 mRNA CTD PMID:37325564 Hsph1 Rat cadmium dichloride increases expression ISO HSPH1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of HSPH1 mRNA CTD PMID:38568856 Hsph1 Rat cadmium dichloride multiple interactions ISO HSPH1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HSPH1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of HSPH1 protein CTD PMID:38195004 Hsph1 Rat cadmium dichloride decreases expression ISO HSPH1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HSPH1 mRNA CTD PMID:38382870 Hsph1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of HSPH1 mRNA CTD PMID:31077537 Hsph1 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in decreased expression of HSPH1 mRNA CTD PMID:31077537 Hsph1 Rat cadmium dichloride increases expression ISO Hsph1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of HSPH1 mRNA CTD PMID:11171528 more ... Hsph1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of HSPH1 mRNA CTD PMID:19010381 Hsph1 Rat cadmium sulfate increases expression ISO HSPH1 (Homo sapiens) 6480464 cadmium sulfate results in increased expression of HSPH1 mRNA CTD PMID:21783983 Hsph1 Rat caffeine decreases phosphorylation ISO HSPH1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of HSPH1 protein CTD PMID:35688186 Hsph1 Rat carbamazepine affects expression ISO HSPH1 (Homo sapiens) 6480464 Carbamazepine affects the expression of HSPH1 mRNA CTD PMID:25979313 Hsph1 Rat carbon nanotube decreases expression ISO Hsph1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of HSPH1 mRNA CTD PMID:25554681 Hsph1 Rat carbon nanotube increases expression ISO Hsph1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of HSPH1 mRNA CTD PMID:25620056 Hsph1 Rat carvedilol increases expression EXP 6480464 carvedilol results in increased expression of HSPH1 protein CTD PMID:20403466 Hsph1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of HSPH1 mRNA CTD PMID:18500788 Hsph1 Rat celastrol increases expression ISO HSPH1 (Homo sapiens) 6480464 celastrol results in increased expression of HSPH1 mRNA CTD PMID:17010675 Hsph1 Rat celastrol decreases expression ISO HSPH1 (Homo sapiens) 6480464 celastrol results in decreased expression of HSPH1 mRNA CTD PMID:39181414 Hsph1 Rat chlordecone increases expression ISO Hsph1 (Mus musculus) 6480464 Chlordecone results in increased expression of HSPH1 mRNA CTD PMID:33711761 Hsph1 Rat chloroethene decreases expression ISO Hsph1 (Mus musculus) 6480464 Vinyl Chloride results in decreased expression of HSPH1 mRNA CTD PMID:18579281 Hsph1 Rat chloropicrin increases expression ISO HSPH1 (Homo sapiens) 6480464 chloropicrin results in increased expression of HSPH1 mRNA CTD PMID:26352163 Hsph1 Rat chlorpyrifos decreases expression ISO Hsph1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of HSPH1 mRNA CTD PMID:37019170 Hsph1 Rat chromium(6+) affects expression ISO Hsph1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of HSPH1 mRNA CTD PMID:28472532 Hsph1 Rat cinnamyl alcohol increases expression ISO HSPH1 (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat clofibrate increases expression ISO Hsph1 (Mus musculus) 6480464 Clofibrate results in increased expression of HSPH1 mRNA CTD PMID:23811191 Hsph1 Rat cobalt dichloride increases expression ISO HSPH1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of HSPH1 mRNA CTD PMID:19320972 and PMID:19376846 Hsph1 Rat copper atom increases expression ISO Hsph1 (Mus musculus) 6480464 Copper results in increased expression of HSPH1 mRNA CTD PMID:16629173 Hsph1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of HSPH1 mRNA CTD PMID:30556269 Hsph1 Rat copper atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of HSPH1 mRNA more ... CTD PMID:24690739 more ... Hsph1 Rat copper(0) increases expression ISO Hsph1 (Mus musculus) 6480464 Copper results in increased expression of HSPH1 mRNA CTD PMID:16629173 Hsph1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of HSPH1 mRNA CTD PMID:30556269 Hsph1 Rat copper(0) multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in increased expression of HSPH1 mRNA more ... CTD PMID:24690739 more ... Hsph1 Rat copper(II) sulfate increases expression ISO HSPH1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of HSPH1 mRNA CTD PMID:19549813 Hsph1 Rat copper(II) sulfate decreases expression ISO Hsph1 (Mus musculus) 6480464 Copper Sulfate results in decreased expression of HSPH1 mRNA CTD PMID:18579281 Hsph1 Rat crocidolite asbestos increases expression ISO HSPH1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of HSPH1 mRNA CTD PMID:25351596 Hsph1 Rat CU-O LINKAGE increases expression ISO HSPH1 (Homo sapiens) 6480464 cupric oxide results in increased expression of HSPH1 mRNA CTD PMID:22077320 Hsph1 Rat Cuprizon multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of HSPH1 protein CTD PMID:34122009 Hsph1 Rat cyclophosphamide increases expression ISO HSPH1 (Homo sapiens) 6480464 Cyclophosphamide metabolite results in increased expression of HSPH1 mRNA CTD PMID:24356939 Hsph1 Rat cyclosporin A increases expression ISO HSPH1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HSPH1 mRNA CTD PMID:20106945 and PMID:25562108 Hsph1 Rat cyclosporin A increases expression ISO Hsph1 (Mus musculus) 6480464 Cyclosporine results in increased expression of HSPH1 mRNA CTD PMID:19770486 Hsph1 Rat cyclosporin A decreases expression ISO HSPH1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HSPH1 mRNA CTD PMID:27989131 Hsph1 Rat decabromodiphenyl ether decreases expression ISO HSPH1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of HSPH1 protein CTD PMID:31675489 Hsph1 Rat deoxynivalenol increases phosphorylation ISO Hsph1 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of HSPH1 protein CTD PMID:23352502 Hsph1 Rat desferrioxamine B multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Deferoxamine results in decreased abundance of Iron] which results in decreased expression of HSPH1 mRNA CTD PMID:12393473 Hsph1 Rat diallyl disulfide multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in decreased expression of HSPH1 mRNA CTD PMID:31077537 Hsph1 Rat diallyl disulfide decreases expression EXP 6480464 diallyl disulfide results in decreased expression of HSPH1 mRNA CTD PMID:31077537 Hsph1 Rat diarsenic trioxide increases expression ISO HSPH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HSPH1 mRNA CTD PMID:17530438 more ... Hsph1 Rat dibenz[a,h]anthracene decreases expression ISO Hsph1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Hsph1 Rat dibenzo[a,l]pyrene decreases expression ISO Hsph1 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of HSPH1 mRNA CTD PMID:25908611 Hsph1 Rat Dibutyl phosphate affects expression ISO HSPH1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HSPH1 mRNA CTD PMID:37042841 Hsph1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of HSPH1 mRNA CTD PMID:15890375 Hsph1 Rat diethylstilbestrol increases expression ISO Hsph1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of HSPH1 mRNA CTD PMID:14664709 Hsph1 Rat dimethylarsinic acid decreases expression ISO Hsph1 (Mus musculus) 6480464 Cacodylic Acid results in decreased expression of HSPH1 mRNA CTD PMID:17441966 Hsph1 Rat dimethylarsinic acid multiple interactions ISO Hsph1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HSPH1 mRNA and OGG1 protein inhibits the reaction [Cacodylic Acid results in decreased expression of HSPH1 mRNA] CTD PMID:17441966 and PMID:34876320 Hsph1 Rat dioxygen decreases expression ISO HSPH1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of HSPH1 mRNA CTD PMID:26516004 Hsph1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of HSPH1 mRNA CTD PMID:33729688 Hsph1 Rat disulfiram multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of HSPH1 mRNA CTD PMID:24690739 Hsph1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of HSPH1 mRNA CTD PMID:21551480 Hsph1 Rat dorsomorphin multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Hsph1 Rat doxorubicin multiple interactions ISO Hsph1 (Mus musculus) 6480464 DMD protein affects the reaction [Doxorubicin results in decreased expression of HSPH1 mRNA] CTD PMID:17888722 Hsph1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of HSPH1 mRNA CTD PMID:30261314 Hsph1 Rat doxorubicin decreases expression ISO Hsph1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of HSPH1 mRNA CTD PMID:17888722 Hsph1 Rat elesclomol increases expression ISO HSPH1 (Homo sapiens) 6480464 elesclomol results in increased expression of HSPH1 mRNA CTD PMID:18723479 Hsph1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of HSPH1 mRNA and Endosulfan results in increased expression of HSPH1 protein CTD PMID:31464424 Hsph1 Rat enzyme inhibitor multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HSPH1 protein CTD PMID:23301498 Hsph1 Rat ethanol affects expression ISO Hsph1 (Mus musculus) 6480464 Ethanol affects the expression of HSPH1 mRNA CTD PMID:30319688 Hsph1 Rat ethanol multiple interactions ISO Hsph1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of HSPH1 mRNA CTD PMID:30319688 Hsph1 Rat eugenol increases expression ISO HSPH1 (Homo sapiens) 6480464 Eugenol results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat fenofibrate increases expression ISO Hsph1 (Mus musculus) 6480464 Fenofibrate results in increased expression of HSPH1 mRNA CTD PMID:21318169 Hsph1 Rat fenofibrate multiple interactions ISO Hsph1 (Mus musculus) 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of HSPH1 mRNA] CTD PMID:21318169 Hsph1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of HSPH1 mRNA CTD PMID:24793618 Hsph1 Rat folic acid multiple interactions ISO Hsph1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HSPH1 mRNA] CTD PMID:22206623 Hsph1 Rat FR900359 affects phosphorylation ISO HSPH1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HSPH1 protein CTD PMID:37730182 Hsph1 Rat furan increases expression ISO Hsph1 (Mus musculus) 6480464 furan results in increased expression of HSPH1 mRNA CTD PMID:24183702 Hsph1 Rat furfural multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Hsph1 Rat gedunin increases expression ISO HSPH1 (Homo sapiens) 6480464 gedunin results in increased expression of HSPH1 mRNA CTD PMID:17010675 Hsph1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of HSPH1 mRNA CTD PMID:17341692 Hsph1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HSPH1 mRNA CTD PMID:33387578 Hsph1 Rat glyoxal increases expression ISO HSPH1 (Homo sapiens) 6480464 Glyoxal results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat haloperidol multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of HSPH1 protein CTD PMID:34122009 Hsph1 Rat hemin multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Hemin results in increased abundance of Iron] which results in increased expression of HSPH1 mRNA CTD PMID:12393473 Hsph1 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Hsph1 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Hsph1 Rat indirubin decreases expression ISO HSPH1 (Homo sapiens) 6480464 indirubin results in decreased expression of HSPH1 mRNA CTD PMID:15056799 Hsph1 Rat inulin multiple interactions ISO Hsph1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of HSPH1 mRNA CTD PMID:36331819 Hsph1 Rat iron atom multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in increased expression of HSPH1 mRNA CTD PMID:22198552 Hsph1 Rat iron atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Deferoxamine results in decreased abundance of Iron] which results in decreased expression of HSPH1 mRNA and [Hemin results in increased abundance of Iron] which results in increased expression of HSPH1 mRNA CTD PMID:12393473 Hsph1 Rat iron(0) multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Deferoxamine results in decreased abundance of Iron] which results in decreased expression of HSPH1 mRNA and [Hemin results in increased abundance of Iron] which results in increased expression of HSPH1 mRNA CTD PMID:12393473 Hsph1 Rat iron(0) multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in increased expression of HSPH1 mRNA CTD PMID:22198552 Hsph1 Rat isoeugenol increases expression ISO HSPH1 (Homo sapiens) 6480464 isoeugenol results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat isoprenaline increases expression ISO Hsph1 (Mus musculus) 6480464 Isoproterenol results in increased expression of HSPH1 mRNA CTD PMID:21335049 Hsph1 Rat ivermectin multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSPH1 mRNA CTD PMID:16861626 Hsph1 Rat ivermectin decreases expression ISO HSPH1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HSPH1 protein CTD PMID:32959892 Hsph1 Rat lead diacetate affects expression ISO Hsph1 (Mus musculus) 6480464 lead acetate affects the expression of HSPH1 mRNA CTD PMID:21829687 Hsph1 Rat lead diacetate decreases expression ISO Hsph1 (Mus musculus) 6480464 lead acetate results in decreased expression of HSPH1 mRNA CTD PMID:25270620 Hsph1 Rat lead(0) affects splicing ISO HSPH1 (Homo sapiens) 6480464 Lead affects the splicing of HSPH1 mRNA CTD PMID:28903495 Hsph1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat Licochalcone B increases expression ISO HSPH1 (Homo sapiens) 6480464 licochalcone B results in increased expression of HSPH1 mRNA CTD PMID:33647349 Hsph1 Rat linalool increases expression EXP 6480464 linalool results in increased expression of HSPH1 mRNA CTD PMID:20536181 Hsph1 Rat lipopolysaccharide multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in increased expression of HSPH1 mRNA CTD PMID:22777745 Hsph1 Rat manganese atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA CTD PMID:39836092 Hsph1 Rat manganese(0) multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA CTD PMID:39836092 Hsph1 Rat manganese(II) chloride multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA CTD PMID:39836092 Hsph1 Rat mercury dibromide multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HSPH1 mRNA CTD PMID:27188386 Hsph1 Rat metacetamol decreases expression ISO Hsph1 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of HSPH1 mRNA CTD PMID:18544908 Hsph1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of HSPH1 mRNA CTD PMID:31324951 Hsph1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of HSPH1 mRNA CTD PMID:15890375 Hsph1 Rat methylarsonic acid multiple interactions ISO Hsph1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HSPH1 mRNA CTD PMID:34876320 Hsph1 Rat methylisothiazolinone increases expression ISO HSPH1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of HSPH1 mRNA CTD PMID:31629900 Hsph1 Rat methylmercury chloride increases expression ISO HSPH1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of HSPH1 mRNA CTD PMID:23179753 more ... Hsph1 Rat methylmercury chloride multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:31878059 Hsph1 Rat motexafin gadolinium increases expression ISO HSPH1 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of HSPH1 mRNA CTD PMID:16357179 Hsph1 Rat motexafin gadolinium multiple interactions ISO HSPH1 (Homo sapiens) 6480464 motexafin gadolinium affects the reaction [Zinc Acetate results in increased expression of HSPH1 mRNA] CTD PMID:16357179 Hsph1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Hsph1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPH1 mRNA CTD PMID:25566086 Hsph1 Rat N-methylformamide increases expression ISO Hsph1 (Mus musculus) 6480464 methylformamide analog results in increased expression of HSPH1 mRNA and methylformamide results in increased expression of HSPH1 mRNA CTD PMID:17040096 Hsph1 Rat N-nitrosodiethylamine increases expression ISO HSPH1 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of HSPH1 mRNA CTD PMID:21527772 Hsph1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of HSPH1 mRNA CTD PMID:15890375 Hsph1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat nickel atom multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in increased expression of HSPH1 mRNA CTD PMID:22198552 Hsph1 Rat nickel atom increases expression ISO HSPH1 (Homo sapiens) 6480464 Nickel results in increased expression of HSPH1 mRNA CTD PMID:24768652 and PMID:25583101 Hsph1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat organoselenium compound multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Organoselenium Compounds binds to Copper] which results in increased expression of HSPH1 mRNA CTD PMID:25167922 Hsph1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] affects the expression of HSPH1 mRNA CTD PMID:25729387 Hsph1 Rat p-chloromercuribenzoic acid increases expression ISO HSPH1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of HSPH1 mRNA CTD PMID:26272509 Hsph1 Rat p-chloromercuribenzoic acid multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HSPH1 mRNA CTD PMID:27188386 Hsph1 Rat paracetamol multiple interactions ISO Hsph1 (Mus musculus) 6480464 PPARA protein affects the reaction [Acetaminophen results in increased expression of HSPH1 mRNA] and PTGS2 protein affects the reaction [Acetaminophen results in increased expression of HSPH1 mRNA] CTD PMID:11743745 and PMID:12958197 Hsph1 Rat paracetamol affects expression ISO Hsph1 (Mus musculus) 6480464 Acetaminophen affects the expression of HSPH1 mRNA CTD PMID:15606129 and PMID:17562736 Hsph1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HSPH1 mRNA CTD PMID:33387578 Hsph1 Rat paracetamol increases expression ISO HSPH1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HSPH1 mRNA CTD PMID:21420995 and PMID:22230336 Hsph1 Rat paracetamol increases expression ISO Hsph1 (Mus musculus) 6480464 Acetaminophen results in increased expression of HSPH1 mRNA CTD PMID:11264010 more ... Hsph1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HSPH1 mRNA CTD PMID:17202762 Hsph1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Hsph1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HSPH1 mRNA more ... CTD PMID:36331819 Hsph1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HSPH1 mRNA CTD PMID:19162173 more ... Hsph1 Rat phenethyl isothiocyanate affects binding ISO HSPH1 (Homo sapiens) 6480464 HSPH1 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Hsph1 Rat phenobarbital multiple interactions ISO Hsph1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of HSPH1 mRNA] CTD PMID:19482888 Hsph1 Rat phenobarbital affects expression ISO Hsph1 (Mus musculus) 6480464 Phenobarbital affects the expression of HSPH1 mRNA CTD PMID:23091169 Hsph1 Rat phenobarbital increases expression ISO Hsph1 (Mus musculus) 6480464 Phenobarbital results in increased expression of HSPH1 mRNA CTD PMID:19270015 and PMID:19482888 Hsph1 Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of HSPH1 mRNA CTD PMID:19162173 Hsph1 Rat phenobarbital decreases expression ISO Hsph1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of HSPH1 mRNA CTD PMID:19270015 Hsph1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of HSPH1 mRNA CTD PMID:15215175 Hsph1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of HSPH1 mRNA CTD PMID:15890375 and PMID:22484513 Hsph1 Rat pirinixic acid decreases expression ISO Hsph1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HSPH1 mRNA CTD PMID:17426115 Hsph1 Rat pirinixic acid increases expression ISO Hsph1 (Mus musculus) 6480464 pirinixic acid results in increased expression of HSPH1 mRNA and pirinixic acid results in increased expression of HSPH1 protein CTD PMID:20059764 more ... Hsph1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of HSPH1 mRNA CTD PMID:15890375 more ... Hsph1 Rat pirinixic acid multiple interactions ISO Hsph1 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of HSPH1 mRNA] and PPARA protein promotes the reaction [pirinixic acid results in increased expression of HSPH1 protein] CTD PMID:20059764 and PMID:21318169 Hsph1 Rat piroxicam decreases expression ISO HSPH1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of HSPH1 mRNA CTD PMID:21858171 Hsph1 Rat potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of HSPH1 protein CTD PMID:18563748 Hsph1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of HSPH1 mRNA CTD PMID:19162173 and PMID:21318169 Hsph1 Rat propiconazole increases expression ISO Hsph1 (Mus musculus) 6480464 propiconazole results in increased expression of HSPH1 mRNA CTD PMID:21278054 Hsph1 Rat prostaglandin A1 increases metabolic processing ISO Hsph1 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of HSPH1 protein CTD PMID:19800325 Hsph1 Rat quercetin increases expression ISO HSPH1 (Homo sapiens) 6480464 Quercetin results in increased expression of HSPH1 mRNA CTD PMID:21632981 Hsph1 Rat rac-lactic acid increases expression ISO HSPH1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of HSPH1 mRNA CTD PMID:23999411 and PMID:30851411 Hsph1 Rat resveratrol multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HSPH1 mRNA CTD PMID:23557933 Hsph1 Rat retinyl acetate increases expression ISO Hsph1 (Mus musculus) 6480464 retinol acetate results in increased expression of HSPH1 mRNA CTD PMID:16772331 Hsph1 Rat ritonavir increases expression ISO HSPH1 (Homo sapiens) 6480464 Ritonavir results in increased expression of HSPH1 protein CTD PMID:26626330 Hsph1 Rat rotenone decreases expression ISO Hsph1 (Mus musculus) 6480464 Rotenone results in decreased expression of HSPH1 mRNA CTD PMID:23186747 Hsph1 Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of HSPH1 mRNA CTD PMID:28374803 Hsph1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of HSPH1 protein CTD PMID:30951809 Hsph1 Rat SB 431542 multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Hsph1 Rat silicon dioxide affects secretion ISO HSPH1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of HSPH1 protein CTD PMID:25895662 Hsph1 Rat silicon dioxide increases expression ISO HSPH1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of HSPH1 mRNA CTD PMID:25351596 Hsph1 Rat silver atom increases expression ISO HSPH1 (Homo sapiens) 6480464 Silver results in increased expression of HSPH1 mRNA CTD PMID:26014281 and PMID:28959546 Hsph1 Rat silver atom increases expression ISO Hsph1 (Mus musculus) 6480464 Silver results in increased expression of HSPH1 mRNA CTD PMID:27131904 Hsph1 Rat silver(0) increases expression ISO HSPH1 (Homo sapiens) 6480464 Silver results in increased expression of HSPH1 mRNA CTD PMID:26014281 and PMID:28959546 Hsph1 Rat silver(0) increases expression ISO Hsph1 (Mus musculus) 6480464 Silver results in increased expression of HSPH1 mRNA CTD PMID:27131904 Hsph1 Rat silver(1+) nitrate increases expression ISO HSPH1 (Homo sapiens) 6480464 Silver Nitrate analog results in increased expression of HSPH1 mRNA CTD PMID:22831968 Hsph1 Rat sodium arsenate multiple interactions ISO Hsph1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HSPH1 mRNA CTD PMID:34876320 Hsph1 Rat sodium arsenite increases expression ISO Hsph1 (Mus musculus) 6480464 sodium arsenite results in increased expression of HSPH1 mRNA CTD PMID:16014739 more ... Hsph1 Rat sodium arsenite multiple interactions ISO Hsph1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HSPH1 mRNA CTD PMID:34876320 Hsph1 Rat sodium arsenite multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of HSPH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HSPH1 mRNA CTD PMID:39836092 Hsph1 Rat sodium arsenite increases expression ISO HSPH1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HSPH1 mRNA CTD PMID:38568856 Hsph1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HSPH1 protein CTD PMID:29459688 Hsph1 Rat sodium chloride multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of HSPH1 protein more ... CTD PMID:38598786 Hsph1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of HSPH1 mRNA CTD PMID:25993096 Hsph1 Rat sodium dichromate decreases expression ISO Hsph1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of HSPH1 mRNA CTD PMID:31558096 Hsph1 Rat sodium dodecyl sulfate increases expression ISO HSPH1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat sulforaphane increases expression ISO HSPH1 (Homo sapiens) 6480464 sulforaphane results in increased expression of HSPH1 mRNA CTD PMID:31838189 Hsph1 Rat sunitinib increases expression ISO HSPH1 (Homo sapiens) 6480464 Sunitinib results in increased expression of HSPH1 mRNA CTD PMID:31533062 Hsph1 Rat tamoxifen affects expression ISO Hsph1 (Mus musculus) 6480464 Tamoxifen affects the expression of HSPH1 mRNA CTD PMID:17555576 Hsph1 Rat temozolomide increases expression ISO HSPH1 (Homo sapiens) 6480464 Temozolomide results in increased expression of HSPH1 mRNA CTD PMID:31758290 Hsph1 Rat tert-butyl hydroperoxide decreases expression ISO HSPH1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of HSPH1 mRNA CTD PMID:15336504 Hsph1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of HSPH1 mRNA CTD PMID:26496021 Hsph1 Rat testosterone decreases expression ISO Hsph1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of HSPH1 mRNA CTD PMID:33848595 Hsph1 Rat testosterone multiple interactions ISO Hsph1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Hsph1 Rat tetrachloromethane increases expression ISO Hsph1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HSPH1 mRNA CTD PMID:15056808 more ... Hsph1 Rat tetrachloromethane decreases expression ISO Hsph1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of HSPH1 mRNA CTD PMID:29987408 Hsph1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HSPH1 mRNA CTD PMID:31150632 Hsph1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HSPH1 mRNA] CTD PMID:31150632 Hsph1 Rat thalidomide increases expression ISO HSPH1 (Homo sapiens) 6480464 Thalidomide analog results in increased expression of HSPH1 mRNA CTD PMID:20525221 Hsph1 Rat thapsigargin increases expression ISO Hsph1 (Mus musculus) 6480464 Thapsigargin results in increased expression of HSPH1 protein CTD PMID:24648495 Hsph1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HSPH1 mRNA CTD PMID:34492290 Hsph1 Rat thiostrepton increases expression ISO HSPH1 (Homo sapiens) 6480464 Thiostrepton results in increased expression of HSPH1 mRNA CTD PMID:22321511 Hsph1 Rat thiram increases expression ISO HSPH1 (Homo sapiens) 6480464 Thiram results in increased expression of HSPH1 mRNA CTD PMID:38568856 Hsph1 Rat titanium dioxide decreases expression ISO Hsph1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of HSPH1 mRNA CTD PMID:23557971 and PMID:29264374 Hsph1 Rat titanium dioxide decreases methylation ISO Hsph1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HSPH1 gene CTD PMID:35295148 Hsph1 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of HSPH1 mRNA CTD PMID:30012374 Hsph1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] affects the expression of HSPH1 mRNA CTD PMID:25729387 Hsph1 Rat torcetrapib increases expression ISO HSPH1 (Homo sapiens) 6480464 torcetrapib results in increased expression of HSPH1 mRNA CTD PMID:23228038 Hsph1 Rat trans-isoeugenol increases expression ISO HSPH1 (Homo sapiens) 6480464 isoeugenol results in increased expression of HSPH1 mRNA CTD PMID:23999411 Hsph1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of HSPH1 mRNA CTD PMID:19448997 Hsph1 Rat triphenyl phosphate affects expression ISO HSPH1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HSPH1 mRNA CTD PMID:37042841 Hsph1 Rat triptonide decreases expression ISO Hsph1 (Mus musculus) 6480464 triptonide results in decreased expression of HSPH1 mRNA CTD PMID:33045310 Hsph1 Rat troglitazone increases expression ISO HSPH1 (Homo sapiens) 6480464 troglitazone results in increased expression of HSPH1 mRNA CTD PMID:19631733 Hsph1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat tungsten multiple interactions EXP 6480464 [Nickel co-treated with Iron co-treated with Tungsten] results in increased expression of HSPH1 mRNA CTD PMID:22198552 Hsph1 Rat tungsten decreases expression ISO Hsph1 (Mus musculus) 6480464 Tungsten results in decreased expression of HSPH1 mRNA CTD PMID:30912803 Hsph1 Rat tunicamycin decreases expression ISO HSPH1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of HSPH1 mRNA CTD PMID:29453283 Hsph1 Rat urethane increases expression ISO HSPH1 (Homo sapiens) 6480464 Urethane results in increased expression of HSPH1 mRNA CTD PMID:28818685 Hsph1 Rat usnic acid multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in increased expression of HSPH1 mRNA CTD PMID:22777745 Hsph1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of HSPH1 mRNA CTD PMID:24136188 Hsph1 Rat valproic acid affects expression ISO Hsph1 (Mus musculus) 6480464 Valproic Acid affects the expression of HSPH1 mRNA CTD PMID:17963808 Hsph1 Rat valproic acid affects expression ISO HSPH1 (Homo sapiens) 6480464 Valproic Acid affects the expression of HSPH1 mRNA CTD PMID:25979313 Hsph1 Rat valproic acid increases expression ISO HSPH1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HSPH1 mRNA CTD PMID:23179753 and PMID:29154799 Hsph1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HSPH1 mRNA CTD PMID:21318169 Hsph1 Rat zearalenone decreases expression ISO Hsph1 (Mus musculus) 6480464 Zearalenone results in decreased expression of HSPH1 protein CTD PMID:36252740 Hsph1 Rat zinc acetate multiple interactions ISO HSPH1 (Homo sapiens) 6480464 motexafin gadolinium affects the reaction [Zinc Acetate results in increased expression of HSPH1 mRNA] CTD PMID:16357179 Hsph1 Rat zinc acetate increases expression ISO HSPH1 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of HSPH1 mRNA CTD PMID:16357179 Hsph1 Rat zinc atom multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HSPH1 mRNA CTD PMID:18593933 Hsph1 Rat zinc pyrithione increases expression ISO HSPH1 (Homo sapiens) 6480464 pyrithione zinc results in increased expression of HSPH1 mRNA CTD PMID:21424779 Hsph1 Rat zinc(0) multiple interactions ISO HSPH1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HSPH1 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (2,4,5-trichlorophenoxy)acetic acid (ISO) (E)-cinnamyl alcohol (ISO) (S)-amphetamine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1,4-phenylenediamine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-fluoro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 2-nitrofluorene (EXP) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 4-phenylbutyric acid (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) 9-cis-retinoic acid (EXP) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) albendazole (ISO) all-trans-retinoic acid (EXP) amitrole (EXP) amphibole asbestos (ISO) Aroclor 1254 (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenous acid (ISO) astemizole (EXP) atrazine (ISO) Aurin (ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A5 (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) carvedilol (EXP) cefaloridine (EXP) celastrol (ISO) chlordecone (ISO) chloroethene (ISO) chloropicrin (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cinnamyl alcohol (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) desferrioxamine B (ISO) diallyl disulfide (EXP) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP,ISO) dimethylarsinic acid (ISO) dioxygen (EXP,ISO) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) elesclomol (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) eugenol (ISO) fenofibrate (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furan (ISO) furfural (ISO) gedunin (ISO) genistein (EXP) gentamycin (EXP) glyoxal (ISO) haloperidol (ISO) hemin (ISO) Indeno[1,2,3-cd]pyrene (ISO) indirubin (ISO) inulin (ISO) iron atom (EXP,ISO) iron(0) (EXP,ISO) isoeugenol (ISO) isoprenaline (ISO) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) leflunomide (EXP) Licochalcone B (ISO) linalool (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) metacetamol (ISO) metformin (EXP) methapyrilene (EXP) methylarsonic acid (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) motexafin gadolinium (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methylformamide (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (EXP,ISO) nimesulide (EXP) organoselenium compound (ISO) oxaliplatin (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) phenobarbital (EXP,ISO) PhIP (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) piroxicam (ISO) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) prostaglandin A1 (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) retinyl acetate (ISO) ritonavir (ISO) rotenone (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) silver(1+) nitrate (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) sodium dodecyl sulfate (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) thapsigargin (ISO) thioacetamide (EXP) thiostrepton (ISO) thiram (ISO) titanium dioxide (EXP,ISO) topotecan (EXP) torcetrapib (ISO) trans-isoeugenol (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (EXP) tungsten (EXP,ISO) tunicamycin (ISO) urethane (ISO) usnic acid (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) zearalenone (ISO) zinc acetate (ISO) zinc atom (ISO) zinc pyrithione (ISO) zinc(0) (ISO)
Hsph1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 10,427,368 - 10,446,602 (+) NCBI GRCr8 mRatBN7.2 12 5,390,916 - 5,410,224 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 5,390,922 - 5,410,224 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 6,069,228 - 6,088,216 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 6,692,653 - 6,711,641 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 5,720,173 - 5,739,161 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 6,322,685 - 6,341,898 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 6,322,668 - 6,341,902 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 8,423,546 - 8,442,481 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 5,794,645 - 5,811,453 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 5,794,644 - 5,811,451 (+) NCBI Celera 12 7,162,640 - 7,181,902 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
HSPH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 31,134,973 - 31,162,388 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 31,134,973 - 31,162,388 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 31,709,110 - 31,736,525 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 30,608,762 - 30,634,117 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 30,608,764 - 30,634,117 NCBI Celera 13 12,778,480 - 12,803,835 (-) NCBI Celera Cytogenetic Map 13 q12.3 NCBI HuRef 13 12,522,150 - 12,547,508 (-) NCBI HuRef CHM1_1 13 31,678,336 - 31,703,689 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 30,358,018 - 30,385,432 (-) NCBI T2T-CHM13v2.0
Hsph1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 149,540,308 - 149,562,594 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 149,537,752 - 149,559,841 (-) Ensembl GRCm39 Ensembl GRCm38 5 149,616,843 - 149,636,498 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 149,614,287 - 149,636,376 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 150,419,420 - 150,438,890 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 149,885,224 - 149,904,597 (-) NCBI MGSCv36 mm8 Celera 5 147,617,650 - 147,637,130 (-) NCBI Celera Cytogenetic Map 5 G3 NCBI cM Map 5 89.18 NCBI
Hsph1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 14,680,498 - 14,706,182 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 14,680,364 - 14,706,182 (+) NCBI ChiLan1.0 ChiLan1.0
HSPH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 30,719,315 - 30,747,378 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 21,826,106 - 21,854,186 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 12,412,826 - 12,438,563 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 30,845,938 - 30,871,455 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 30,846,631 - 30,871,161 (-) Ensembl panpan1.1 panPan2
HSPH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 8,972,942 - 8,998,404 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 8,972,724 - 8,997,893 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 9,015,922 - 9,040,982 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 9,077,842 - 9,102,910 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 9,077,554 - 9,102,903 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 8,977,129 - 9,002,182 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 8,985,129 - 9,010,177 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 9,027,003 - 9,052,061 (+) NCBI UU_Cfam_GSD_1.0
Hsph1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 170,073,174 - 170,096,453 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 25,855,694 - 25,879,062 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 25,855,873 - 25,879,062 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HSPH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 7,733,878 - 7,759,576 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 7,733,874 - 7,759,528 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 7,585,525 - 7,587,259 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 11 7,637,260 - 7,661,067 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HSPH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 9,999,471 - 10,026,106 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 10,000,109 - 10,026,449 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 34,342,051 - 34,369,001 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hsph1
.
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 93 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000001201 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 724526 Uae3 Urinary albumin excretion QTL 3 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 12 3906969 10373166 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 797729 8525593 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat
RH129540
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 5,404,469 - 5,404,655 (-) MAPPER mRatBN7.2 Rnor_6.0 12 6,328,232 - 6,328,417 NCBI Rnor6.0 Rnor_5.0 12 8,429,093 - 8,429,278 UniSTS Rnor5.0 RGSC_v3.4 12 5,805,613 - 5,805,798 UniSTS RGSC3.4 Celera 12 7,176,148 - 7,176,333 UniSTS RH 3.4 Map 12 40.36 UniSTS Cytogenetic Map 12 p11 UniSTS
AI600071
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 5,409,995 - 5,410,129 (-) MAPPER mRatBN7.2 Rnor_6.0 12 6,322,780 - 6,322,913 NCBI Rnor6.0 Rnor_5.0 12 8,423,641 - 8,423,774 UniSTS Rnor5.0 RGSC_v3.4 12 5,811,225 - 5,811,358 UniSTS RGSC3.4 Celera 12 7,181,674 - 7,181,807 UniSTS RH 3.4 Map 12 58.1 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001201 ⟹ ENSRNOP00000001201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 5,390,922 - 5,410,224 (+) Ensembl Rnor_6.0 Ensembl 12 6,322,668 - 6,341,902 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104544 ⟹ ENSRNOP00000095841
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 5,390,922 - 5,410,224 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116960 ⟹ ENSRNOP00000082622
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 5,390,922 - 5,410,224 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119657 ⟹ ENSRNOP00000089171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 5,391,809 - 5,410,224 (+) Ensembl
RefSeq Acc Id:
NM_001011901 ⟹ NP_001011901
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 10,427,368 - 10,446,602 (+) NCBI mRatBN7.2 12 5,390,990 - 5,410,224 (+) NCBI Rnor_6.0 12 6,322,685 - 6,341,898 (-) NCBI Rnor_5.0 12 8,423,546 - 8,442,481 (-) NCBI RGSC_v3.4 12 5,794,645 - 5,811,453 (+) RGD Celera 12 7,162,640 - 7,181,902 (+) RGD
Sequence:
GAGCGATTGGGACCTCCCCTTTTGGATTGGTAGCTGAGCGGCAGTGGCGGCGGCTGCGTGAGAGAGGCGAGCGGCGGAGAGCGGTGGCAAATACTGAACGCAGTCTCGCAGGGTAAGCCCGAGGCATC
hide sequence
RefSeq Acc Id:
XM_039089153 ⟹ XP_038945081
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 10,427,443 - 10,446,602 (+) NCBI mRatBN7.2 12 5,390,916 - 5,410,224 (+) NCBI
RefSeq Acc Id:
XM_063271115 ⟹ XP_063127185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 10,429,777 - 10,446,602 (+) NCBI
RefSeq Acc Id:
NP_001011901 ⟸ NM_001011901
- UniProtKB:
Q66HA8 (UniProtKB/Swiss-Prot), A6K161 (UniProtKB/TrEMBL), A0A8I6GLC4 (UniProtKB/TrEMBL)
- Sequence:
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGPKNRTIGVAAKNQQITHANNTVSSFKRFHGRAFNDPFIQKEKENLSYDLVPMKNGGVGIKVMYMDEDHLFSVEQITAMLLTKLKET
hide sequence
Ensembl Acc Id:
ENSRNOP00000001201 ⟸ ENSRNOT00000001201
RefSeq Acc Id:
XP_038945081 ⟸ XM_039089153
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZXF4 (UniProtKB/TrEMBL), A0A8I6GLC4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082622 ⟸ ENSRNOT00000116960
Ensembl Acc Id:
ENSRNOP00000089171 ⟸ ENSRNOT00000119657
Ensembl Acc Id:
ENSRNOP00000095841 ⟸ ENSRNOT00000104544
RefSeq Acc Id:
XP_063127185 ⟸ XM_063271115
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AB23 (UniProtKB/TrEMBL)
RGD ID: 13698388 Promoter ID: EPDNEW_R8913 Type: initiation region Name: Hsph1_1 Description: heat shock protein family H member 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 6,341,875 - 6,341,935 EPDNEW
BioCyc Gene G2FUF-20203 BioCyc
Ensembl Genes ENSRNOG00000000902 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000001201 ENTREZGENE
ENSRNOT00000001201.8 UniProtKB/Swiss-Prot
ENSRNOT00000116960 ENTREZGENE
Gene3D-CATH 1.20.1270.10 UniProtKB/Swiss-Prot
3.30.30.30 UniProtKB/Swiss-Prot
3.30.420.40 UniProtKB/Swiss-Prot
Actin, Chain A, domain 4 UniProtKB/Swiss-Prot
Substrate Binding Domain Of DNAk, Chain A, domain 1 UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:7121434 IMAGE-MGC_LOAD
InterPro ATPase_NBD UniProtKB/Swiss-Prot
Heat_shock_70_CS UniProtKB/Swiss-Prot
HSP70_C_sf UniProtKB/Swiss-Prot
HSP70_peptide-bd_sf UniProtKB/Swiss-Prot
Hsp_70_fam UniProtKB/Swiss-Prot
HSPH1_NBD UniProtKB/Swiss-Prot
KEGG Report rno:288444 UniProtKB/Swiss-Prot
MGC_CLONE MGC:94016 IMAGE-MGC_LOAD
NCBI Gene 288444 ENTREZGENE
PANTHER HEAT SHOCK PROTEIN 105 KDA UniProtKB/Swiss-Prot
HSC70CB, ISOFORM G-RELATED UniProtKB/Swiss-Prot
Pfam HSP70 UniProtKB/Swiss-Prot
PhenoGen Hsph1 PhenoGen
PRINTS HEATSHOCK70 UniProtKB/Swiss-Prot
PROSITE HSP70_3 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000000902 RatGTEx
Superfamily-SCOP SSF100920 UniProtKB/Swiss-Prot
SSF100934 UniProtKB/Swiss-Prot
SSF53067 UniProtKB/Swiss-Prot
UniProt A0A8I5ZXF4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AB23 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GLC4 ENTREZGENE, UniProtKB/TrEMBL
A6K161 ENTREZGENE, UniProtKB/TrEMBL
HS105_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-11
Hsph1
heat shock protein family H (Hsp110) member 1
Hsph1
heat shock 105/110 protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-04-27
Hsph1
heat shock 105/110 protein 1
Hsph1
heat shock 105kDa/110kDa protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Hsph1
heat shock 105kDa/110kDa protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Hsph1
heat shock 105kDa/110kDa protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Hsph1
heat shock 105kDa/110kDa protein 1
Hsp105
heat shock protein 105
Symbol and Name updated
1299863 APPROVED
2005-12-06
Hsp105
heat shock protein 105
Hsp105_predicted
heat shock protein 105 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Hsp105_predicted
heat shock protein 105 (predicted)
Symbol and Name status set to approved
70820 APPROVED
