Advanced Search (OLGA)

Gene: Mrps10 (mitochondrial ribosomal protein S10) Rattus norvegicus

Analyze

Symbol:

Mrps10

Name:

mitochondrial ribosomal protein S10

RGD ID:

1311516

Description:

Predicted to be located in ribosome. Predicted to be part of mitochondrial small ribosomal subunit. Predicted to be active in mitochondrion. Orthologous to human MRPS10 (mitochondrial ribosomal protein S10); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

28S ribosomal protein S10, mitochondrial; Ac1179; liver regeneration-related protein LRRG099; LOC363187; MRP-S10; S10mt; small ribosomal subunit protein uS10m

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS10 (mitochondrial ribosomal protein S10)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Mrps10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mrps10 (mitochondrial ribosomal protein S10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LENG1 (leukocyte receptor cluster member 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPS10 (mitochondrial ribosomal protein S10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps10 (mitochondrial ribosomal protein S10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps10 (mitochondrial ribosomal protein S10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mRpS10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrps10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,112,549 - 21,122,461 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	21,112,549 - 21,122,453 (-)	Ensembl				GRCr8
mRatBN7.2	9	13,614,897 - 13,624,819 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,614,897 - 13,624,779 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	22,195,094 - 22,205,027 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,258,950 - 27,268,883 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,558,500 - 25,568,433 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,637,427 - 15,651,154 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,637,268 - 15,646,846 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,558,417 - 14,572,144 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	9,074,191 - 9,087,917 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,366,139 - 11,379,865 (-)	NCBI		Celera
RGSC_v3.1	9	9,071,512 - 9,085,239 (-)	NCBI
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Zellweger syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

aconitine (EXP)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

folic acid (ISO)

furan (EXP)

inulin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

N-methyl-4-phenylpyridinium (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

rotenone (EXP)

silver atom (ISO)

silver(0) (ISO)

tetrachloromethane (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial small ribosomal subunit (IEA,ISO,ISS)

mitochondrion (IBA,IEA)

ribonucleoprotein complex (IEA)

ribosome (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:25838379	PMID:34800366

Genomics

Comparative Map Data

Mrps10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,112,549 - 21,122,461 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	21,112,549 - 21,122,453 (-)	Ensembl				GRCr8
mRatBN7.2	9	13,614,897 - 13,624,819 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,614,897 - 13,624,779 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	22,195,094 - 22,205,027 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,258,950 - 27,268,883 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,558,500 - 25,568,433 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,637,427 - 15,651,154 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,637,268 - 15,646,846 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,558,417 - 14,572,144 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	9,074,191 - 9,087,917 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,366,139 - 11,379,865 (-)	NCBI		Celera
RGSC_v3.1	9	9,071,512 - 9,085,239 (-)	NCBI
Cytogenetic Map	9	q12	NCBI

MRPS10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	42,206,807 - 42,217,861 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	42,206,694 - 42,217,881 (-)	Ensembl			hg38	GRCh38
GRCh37	6	42,174,545 - 42,185,599 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	42,282,517 - 42,293,581 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	42,282,516 - 42,293,581	NCBI
Celera	6	43,726,978 - 43,738,077 (-)	NCBI		Celera
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	41,892,504 - 41,903,416 (-)	NCBI		HuRef
CHM1_1	6	42,176,999 - 42,188,103 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	42,035,014 - 42,046,095 (-)	NCBI		T2T-CHM13v2.0

Mrps10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	47,679,803 - 47,692,343 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	47,679,812 - 47,692,342 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	47,368,887 - 47,381,418 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	47,368,887 - 47,381,417 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	47,505,836 - 47,515,628 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	46,832,388 - 46,841,870 (+)	NCBI		MGSCv36	mm8
Celera	17	50,803,702 - 50,813,494 (+)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	23.0	NCBI

Mrps10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	8,398,812 - 8,407,531 (-)	Ensembl
ChiLan1.0	NW_004955437	8,399,233 - 8,407,525 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPS10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	56,702,818 - 56,715,364 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	52,572,818 - 52,585,390 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	41,794,953 - 41,806,061 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	43,095,589 - 43,106,288 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	43,095,589 - 43,106,288 (-)	Ensembl			panPan2	panpan1.1

MRPS10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	10,813,982 - 10,833,403 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	10,843,301 - 10,862,706 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	11,295,288 - 11,314,712 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	11,279,226 - 11,314,697 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	10,824,811 - 10,844,209 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	10,908,687 - 10,928,098 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	11,002,960 - 11,022,366 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mrps10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	46,289,462 - 46,301,226 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	17,659,082 - 17,667,973 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	17,659,055 - 17,669,280 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	37,318,346 - 37,329,167 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	37,318,344 - 37,329,246 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	42,774,446 - 42,785,535 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	29,934,236 - 29,946,589 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	29,934,274 - 29,947,949 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	42,230,143 - 42,242,498 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	17,066,569 - 17,080,557 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	17,066,596 - 17,075,855 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mrps10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	82,502,805 - 82,512,719 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mrps10
50 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	80
Interacting mature miRNAs:	87
Transcripts:	ENSRNOT00000040204
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	21707400	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	6714888	29567695	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	21031430	49025574	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001389252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006244464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006244465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY310148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000040204 ⟹ ENSRNOP00000046067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	21,112,549 - 21,122,420 (-)	Ensembl
mRatBN7.2 Ensembl	9	13,614,897 - 13,624,769 (-)	Ensembl
Rnor_6.0 Ensembl	9	15,637,428 - 15,646,381 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087971 ⟹ ENSRNOP00000074250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	13,614,897 - 13,622,023 (-)	Ensembl
Rnor_6.0 Ensembl	9	15,637,268 - 15,646,846 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104196 ⟹ ENSRNOP00000079780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	21,112,549 - 21,117,202 (-)	Ensembl
mRatBN7.2 Ensembl	9	13,614,897 - 13,619,551 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116536 ⟹ ENSRNOP00000094901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	21,112,549 - 21,122,453 (-)	Ensembl
mRatBN7.2 Ensembl	9	13,614,897 - 13,624,779 (-)	Ensembl

RefSeq Acc Id:

NM_001389252 ⟹ NP_001376181

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,112,549 - 21,122,453 (-)	NCBI
mRatBN7.2	9	13,614,897 - 13,624,802 (-)	NCBI

RefSeq Acc Id:

XM_006244465 ⟹ XP_006244527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,112,849 - 21,122,461 (-)	NCBI
mRatBN7.2	9	13,615,153 - 13,624,819 (-)	NCBI
Rnor_6.0	9	15,637,427 - 15,646,440 (-)	NCBI
Rnor_5.0	9	14,558,417 - 14,572,144 (-)	NCBI

Sequence:

show sequence

TATGGTTCGAGGGCACGGCTGTGATCCCGGAAGCGATCGTGGGAGGTCAGGGCACCAAGATGGC
GGCGCGCGCAGCGTGTGTGGCTGTCTGCCGGCGCCTGCAGCAGGAATTGGGGAATTCATCTATA
AATGGTGCTAGGAGCAGTACAATCAGAACTCGAGGCCTCCTGTTTGCCAGGATGAAGTGGGTAC
CATTGTCAAATCTGCACATGGATGTCCCAAAGGATCTGGTCAGACCTACGATAACCACTTCTGA
TGAGCCAGACACGTTGTACAAACGCCTGTCCATTTTAGTGAAAGCCCATGACAAGGCTGTATTA
GACAGTTATGAGTATTTTGCCGTGCTCGCTGCTAAAGAACTTGGCCTTTCTATTAAAGTACACG
AGCCACCCAGGAAAATAGAGCGCTTCACTCTCCTCAAGTCAGTGCACATCTTCAAGAAGCACAG
AGTCCAGTATGAGATGAGGACGCTCTACAGATGTCTGGAGTTAAAACATTTGACCGGATGCACA
GCCAATGTCTACCTGGAATACATCCAGCGAAACCTACCTGAAGGGGTGGCCATGGAAGTGACAA
AGACACAGATACAGCAGTTGCCAGAGCACATCAAGGAGCCAATGTGGGAAACAGTTTCCGGGGA
GAAAGAAGAAACCAAATCATAAA

hide sequence

RefSeq Acc Id:

XM_039083813 ⟹ XP_038939741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,112,849 - 21,122,451 (-)	NCBI
mRatBN7.2	9	13,615,153 - 13,624,819 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001376181	(Get FASTA)	NCBI Sequence Viewer
	XP_006244527	(Get FASTA)	NCBI Sequence Viewer
	XP_038939741	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP78756	(Get FASTA)	NCBI Sequence Viewer
	EDM18873	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000046067.2
	ENSRNOP00000094901
GenBank Protein	Q7TQ82	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_006244527 ⟸ XM_006244465
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K7L0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAARAACVAVCRRLQQELGNSSINGARSSTIRTRGLLFARMKWVPLSNLHMDVPKDLVRPTITT SDEPDTLYKRLSILVKAHDKAVLDSYEYFAVLAAKELGLSIKVHEPPRKIERFTLLKSVHIFKK HRVQYEMRTLYRCLELKHLTGCTANVYLEYIQRNLPEGVAMEVTKTQIQQLPEHIKEPMWETVS GEKEETKS hide sequence

Ensembl Acc Id:

ENSRNOP00000074250 ⟸ ENSRNOT00000087971

Ensembl Acc Id:

ENSRNOP00000046067 ⟸ ENSRNOT00000040204

RefSeq Acc Id:	NP_001376181 ⟸ NM_001389252
- UniProtKB:	A0A8I6ALP1 (UniProtKB/TrEMBL), A6JIK7 (UniProtKB/TrEMBL), A0A0G2K7L0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038939741 ⟸ XM_039083813
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K7L0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094901 ⟸ ENSRNOT00000116536

Ensembl Acc Id:

ENSRNOP00000079780 ⟸ ENSRNOT00000104196

Protein Domains

Small ribosomal subunit protein uS10

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TQ82-F1-model_v2	AlphaFold	Q7TQ82	1-155	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696500

Promoter ID:

EPDNEW_R7024

Type:

multiple initiation site

Name:

Mrps10_1

Description:

mitochondrial ribosomal protein S10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	15,646,392 - 15,646,452	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311516	AgrOrtholog
BioCyc Gene	G2FUF-28259	BioCyc
Ensembl Genes	ENSRNOG00000022609	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000040204.3	UniProtKB/Swiss-Prot
	ENSRNOT00000116536	ENTREZGENE
Gene3D-CATH	3.30.70.600	UniProtKB/Swiss-Prot
InterPro	MRPS10	UniProtKB/Swiss-Prot
	Ribosomal_S10_dom	UniProtKB/Swiss-Prot
	Ribosomal_S10_dom_sf	UniProtKB/Swiss-Prot
NCBI Gene	363187	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S10, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR13334	UniProtKB/Swiss-Prot
Pfam	Ribosomal_S10	UniProtKB/Swiss-Prot
PhenoGen	Mrps10	PhenoGen
RatGTEx	ENSRNOG00000022609	RatGTEx
SMART	Ribosomal_S10	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54999	UniProtKB/Swiss-Prot
UniProt	A0A0G2K7L0	ENTREZGENE
	A0A8I5ZNN0_RAT	UniProtKB/TrEMBL
	A0A8I6ALP1	ENTREZGENE, UniProtKB/TrEMBL
	A6JIK7	ENTREZGENE, UniProtKB/TrEMBL
	Q7TQ82	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Mrps10	mitochondrial ribosomal protein S10	Mrps10_predicted	mitochondrial ribosomal protein S10 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mrps10_predicted	mitochondrial ribosomal protein S10 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar