Advanced Search (OLGA)

Gene: Pfdn5 (prefoldin subunit 5) Rattus norvegicus

Analyze

Symbol:

Pfdn5

Name:

prefoldin subunit 5

RGD ID:

1311436

Description:

Predicted to enable amyloid-beta binding activity and unfolded protein binding activity. Predicted to be involved in several processes, including negative regulation of canonical Wnt signaling pathway; negative regulation of macromolecule metabolic process; and protein-containing complex assembly. Predicted to act upstream of or within retina development in camera-type eye. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be part of prefoldin complex. Predicted to be active in cytoplasm. Orthologous to human PFDN5 (prefoldin subunit 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC300257; prefoldin 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PFDN5 (prefoldin subunit 5)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pfdn5 (prefoldin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pfdn5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PFDN5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PFDN5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pfdn5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PFDN5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PFDN5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pfdn5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pfdn5 (prefoldin subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PFDN5 (prefoldin subunit 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	PFDN5 (prefoldin subunit 5)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pfdn5 (prefoldin 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Pfdn5 (prefoldin 5)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pfdn5 (prefoldin 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GIM5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pfdn5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pfd-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pfd-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pfdn5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pfdn5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	135,330,364 - 135,335,102 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	135,330,172 - 135,335,099 (+)	Ensembl				GRCr8
mRatBN7.2	7	133,451,778 - 133,456,516 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	133,451,453 - 133,456,516 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	135,212,778 - 135,217,515 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	137,442,158 - 137,446,895 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	137,427,322 - 137,432,043 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	143,924,662 - 143,929,400 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	143,924,662 - 143,929,397 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	141,720,703 - 141,725,442 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	141,075,469 - 141,080,207 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	129,885,186 - 129,889,924 (+)	NCBI		Celera
RGSC_v3.1	7	141,151,896 - 141,156,640 (+)	NCBI
Cytogenetic Map	7	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

biochanin A (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

cisplatin (ISO)

clozapine (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fipronil (EXP)

folic acid (ISO)

gentamycin (EXP)

haloperidol (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead diacetate (ISO)

methimazole (EXP)

methylparaben (ISO)

methylseleninic acid (ISO)

nimesulide (EXP)

okadaic acid (ISO)

ouabain (ISO)

PCB138 (ISO)

phenobarbital (EXP)

rac-lactic acid (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

tolcapone (EXP)

toluene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of amyloid fibril formation (IEA,ISO)

negative regulation of canonical Wnt signaling pathway (IEA,ISO)

negative regulation of DNA-templated transcription (IEA,ISO)

protein folding (IEA,ISO)

retina development in camera-type eye (ISO)

RNA polymerase I assembly (IBA)

RNA polymerase II core complex assembly (IBA)

RNA polymerase III assembly (IBA)

Cellular Component

cytoplasm (IBA)

cytosol (IEA,ISO)

prefoldin complex (IBA,IEA,ISO)

Molecular Function

amyloid-beta binding (IEA,ISO)

protein binding (ISO)

unfolded protein binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:15277470	PMID:18281035	PMID:21052544	PMID:31505169

Genomics

Comparative Map Data

Pfdn5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	135,330,364 - 135,335,102 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	135,330,172 - 135,335,099 (+)	Ensembl				GRCr8
mRatBN7.2	7	133,451,778 - 133,456,516 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	133,451,453 - 133,456,516 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	135,212,778 - 135,217,515 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	137,442,158 - 137,446,895 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	137,427,322 - 137,432,043 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	143,924,662 - 143,929,400 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	143,924,662 - 143,929,397 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	141,720,703 - 141,725,442 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	141,075,469 - 141,080,207 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	129,885,186 - 129,889,924 (+)	NCBI		Celera
RGSC_v3.1	7	141,151,896 - 141,156,640 (+)	NCBI
Cytogenetic Map	7	q36	NCBI

PFDN5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	53,295,542 - 53,299,450 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	53,295,291 - 53,299,452 (+)	Ensembl			hg38	GRCh38
GRCh37	12	53,689,326 - 53,693,234 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	51,975,502 - 51,979,501 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	51,975,583 - 51,979,499	NCBI
Celera	12	53,338,519 - 53,342,520 (+)	NCBI		Celera
Cytogenetic Map	12	q13.13	NCBI
HuRef	12	50,730,741 - 50,734,757 (+)	NCBI		HuRef
CHM1_1	12	53,655,676 - 53,659,674 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	53,261,253 - 53,265,162 (+)	NCBI		T2T-CHM13v2.0

Pfdn5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	102,234,551 - 102,239,925 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	102,234,551 - 102,240,308 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	102,326,116 - 102,331,490 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	102,326,116 - 102,331,873 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	102,156,547 - 102,161,921 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	102,154,207 - 102,159,524 (+)	NCBI		MGSCv36	mm8
Celera	15	104,483,173 - 104,488,550 (+)	NCBI		Celera
Cytogenetic Map	15	F2	NCBI
cM Map	15	57.48	NCBI

Pfdn5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	555,971 - 559,927 (+)	Ensembl
ChiLan1.0	NW_004955458	555,971 - 559,927 (+)	NCBI	ChiLan1.0	ChiLan1.0

PFDN5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	40,886,410 - 40,890,398 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	40,883,175 - 40,887,118 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	35,454,680 - 35,458,667 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	36,235,552 - 36,239,706 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	36,235,552 - 36,239,706 (-)	Ensembl			panPan2	panpan1.1

PFDN5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	1,906,133 - 1,909,613 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	1,906,133 - 1,909,613 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	44,339,679 - 44,343,149 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	1,910,594 - 1,914,080 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	1,910,594 - 1,914,080 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	1,928,914 - 1,932,377 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	1,913,828 - 1,917,308 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	44,740,367 - 44,743,847 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pfdn5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	62,581,355 - 62,585,151 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	10,579,635 - 10,599,554 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	10,579,657 - 10,583,477 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PFDN5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	18,512,697 - 18,517,174 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	18,512,637 - 18,516,928 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	18,948,398 - 18,952,665 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PFDN5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	49,407,855 - 49,410,680 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	49,407,761 - 49,411,598 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	196,651,830 - 196,656,242 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pfdn5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624904	1,332,579 - 1,337,795 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624904	1,332,518 - 1,336,266 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pfdn5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	260,751,378 - 260,755,993 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	45
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000017794
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	121393075	137014596	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	132099939	137014596	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	119280025	135560836	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

BF407910

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	133,450,688 - 133,450,825 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	143,923,573 - 143,923,709	NCBI	Rnor6.0
Rnor_5.0	7	141,719,614 - 141,719,750	UniSTS	Rnor5.0
RGSC_v3.4	7	141,074,380 - 141,074,516	UniSTS	RGSC3.4
Celera	7	129,884,097 - 129,884,233	UniSTS
RH 3.4 Map	7	1065.0	UniSTS
Cytogenetic Map	7	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI576681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC169128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF976389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF976393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017794 ⟹ ENSRNOP00000017794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	135,330,172 - 135,335,099 (+)	Ensembl
mRatBN7.2 Ensembl	7	133,451,778 - 133,456,513 (+)	Ensembl
Rnor_6.0 Ensembl	7	143,924,662 - 143,929,397 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109593 ⟹ ENSRNOP00000077663

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	135,330,172 - 135,335,099 (+)	Ensembl
mRatBN7.2 Ensembl	7	133,451,778 - 133,456,513 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120166 ⟹ ENSRNOP00000087002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	135,330,208 - 135,335,099 (+)	Ensembl
mRatBN7.2 Ensembl	7	133,451,453 - 133,456,516 (+)	Ensembl

RefSeq Acc Id:

NM_001106794 ⟹ NP_001100264

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	135,330,364 - 135,335,102 (+)	NCBI
mRatBN7.2	7	133,451,778 - 133,456,516 (+)	NCBI
Rnor_6.0	7	143,924,662 - 143,929,400 (+)	NCBI
Rnor_5.0	7	141,720,703 - 141,725,442 (+)	NCBI
RGSC_v3.4	7	141,075,469 - 141,080,207 (+)	RGD
Celera	7	129,885,186 - 129,889,924 (+)	RGD

Sequence:

show sequence

GCTCGCCTAGCCGGCTTCCGCTTCGGCATTCCTCCTTCCCAACATGGCGCAGTCGATTAACATC
ACGGAGCTGAATCTGCCACAACTGGAAATGCTCAAGAACCAGCTGGACCAGGAAGTGGAGTTTT
TGTCCACGTCAATTGCTCAGCTCAAGGTGGTACAGACTAAGTATGTGGAAGCCAAGGACTGTCT
GAACGTGCTGAACAAGAGCAACGAGGGAAAAGAATTACTGGTCCCACTGACGAGTTCTATGTAT
GTCCCCGGGAAGCTCCACGATGTGGAACATGTGCTTATCGATGTGGGAACTGGTTACTACGTGG
AGAAGACAGCTGAGGATGCCAAGGACTTCTTCAAAAGGAAGATAGACTTTCTTACCAAACAGAT
GGAGAAAATCCAGCCAGCTCTGCAGGAGAAGCATGCCATGAAACAAGCCGTCGTGGAAATGATG
AGCCAGAAGATTCAGCAGCTCACAGCCCTGGGGGCAACGCAGGCCACTGCCAAGGCATGAGAAT
GTGTCGCGGAAACGAAGCAGAGAAGGACCCTTTTTCAAGGGGCCTGGGACTTTTTTTGGCAGTG
GCCTCCTGGGAAAGTGTCTGGGAAGAGAGGGTCTTGTGTTTAATGTTAATAAATGTGCCAGCTG
TGCAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100264	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI69128	(Get FASTA)	NCBI Sequence Viewer
	EDL86847	(Get FASTA)	NCBI Sequence Viewer
	EDL86848	(Get FASTA)	NCBI Sequence Viewer
	EDL86849	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017794
	ENSRNOP00000017794.7
	ENSRNOP00000077663.1
	ENSRNOP00000087002.2

RefSeq Acc Id:	NP_001100264 ⟸ NM_001106794
- UniProtKB:	B5DFN4 (UniProtKB/TrEMBL), F7FF81 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLV PLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMK QAVVEMMSQKIQQLTALGATQATAKA hide sequence

Ensembl Acc Id:

ENSRNOP00000017794 ⟸ ENSRNOT00000017794

Ensembl Acc Id:

ENSRNOP00000077663 ⟸ ENSRNOT00000109593

Ensembl Acc Id:

ENSRNOP00000087002 ⟸ ENSRNOT00000120166

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DFN4-F1-model_v2	AlphaFold	B5DFN4	1-154	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695696

Promoter ID:

EPDNEW_R6221

Type:

multiple initiation site

Name:

Pfdn5_1

Description:

prefoldin subunit 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	143,924,696 - 143,924,756	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311436	AgrOrtholog
BioCyc Gene	G2FUF-31941	BioCyc
Ensembl Genes	ENSRNOG00000012985	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017794	ENTREZGENE
	ENSRNOT00000017794.7	UniProtKB/TrEMBL
	ENSRNOT00000109593.2	UniProtKB/TrEMBL
	ENSRNOT00000120166.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.370	UniProtKB/TrEMBL
InterPro	PFD_alpha	UniProtKB/TrEMBL
	PFD_alpha-like	UniProtKB/TrEMBL
	Prefoldin	UniProtKB/TrEMBL
KEGG Report	rno:300257	UniProtKB/TrEMBL
NCBI Gene	300257	ENTREZGENE
PANTHER	PREFOLDIN SUBUNIT 5	UniProtKB/TrEMBL
	PTHR12674	UniProtKB/TrEMBL
Pfam	Prefoldin	UniProtKB/TrEMBL
PhenoGen	Pfdn5	PhenoGen
RatGTEx	ENSRNOG00000012985	RatGTEx
Superfamily-SCOP	Prefoldin	UniProtKB/TrEMBL
UniProt	A0A8I5Y1V4_RAT	UniProtKB/TrEMBL
	A0A8I6A3H8_RAT	UniProtKB/TrEMBL
	A6KCU5_RAT	UniProtKB/TrEMBL
	B5DFN4	ENTREZGENE, UniProtKB/TrEMBL
	F7FF81	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Pfdn5	prefoldin subunit 5	Pfdn5	prefoldin 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Pfdn5	prefoldin 5	Pfdn5_predicted	prefoldin 5 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pfdn5_predicted	prefoldin 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message