Symbol:
Mmp19
Name:
matrix metallopeptidase 19
RGD ID:
1311376
Description:
Predicted to enable metalloendopeptidase activity. Involved in female gonad development; response to cAMP; and response to hormone. Predicted to be located in extracellular matrix. Orthologous to human MMP19 (matrix metallopeptidase 19); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC304608; matrix metalloproteinase 19; matrix metalloproteinase-19; MMP-19
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MMP19 (matrix metallopeptidase 19)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mmp19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mmp19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MMP19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MMP19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mmp19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MMP19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MMP19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mmp19 (matrix metallopeptidase 19)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MMP26 (matrix metallopeptidase 26)
HGNC
Treefam
Homo sapiens (human):
MAP3K10 (mitogen-activated protein kinase kinase kinase 10)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MMP19 (matrix metallopeptidase 19)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mmp19 (matrix metallopeptidase 19)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mmp19 (matrix metallopeptidase 19)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
zmp-4
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
Y50D7A.13
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
W01F3.2
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
K03B8.6
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
mmp19
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,805,732 - 1,814,054 (+) NCBI GRCr8 mRatBN7.2 7 1,221,229 - 1,229,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 1,221,343 - 1,229,555 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,984,499 - 3,992,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,860,160 - 5,867,860 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 6,157,051 - 6,164,751 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 3,216,392 - 3,224,202 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 3,216,497 - 3,224,201 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 3,187,758 - 3,195,773 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 2,091,532 - 2,099,235 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 2,091,513 - 2,098,874 (+) NCBI Celera 7 1,092,107 - 1,099,811 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mmp19 Rat 1,1,1-trichloroethane decreases expression ISO Mmp19 (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Mmp19 Rat 1,2-dimethylhydrazine multiple interactions ISO Mmp19 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of MMP19 mRNA] CTD PMID:22206623 Mmp19 Rat 1,2-dimethylhydrazine decreases expression ISO Mmp19 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MMP19 mRNA CTD PMID:22206623 Mmp19 Rat 17beta-estradiol multiple interactions ISO MMP19 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of MMP19 mRNA CTD PMID:30165855 Mmp19 Rat 17beta-estradiol decreases expression ISO MMP19 (Homo sapiens) 6480464 Estradiol results in decreased expression of MMP19 mRNA CTD PMID:31614463 Mmp19 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO MMP19 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Mmp19 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MMP19 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mmp19 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mmp19 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MMP19 mRNA CTD PMID:16962184 Mmp19 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MMP19 mRNA CTD PMID:33387578 Mmp19 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MMP19 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MMP19 mRNA CTD PMID:22574217 Mmp19 Rat 2,4,6-tribromophenol increases expression ISO MMP19 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mmp19 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MMP19 mRNA CTD PMID:21346803 Mmp19 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Mmp19 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of MMP19 mRNA CTD PMID:25172293 Mmp19 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO MMP19 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of MMP19 protein CTD PMID:31675489 Mmp19 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MMP19 mRNA more ... CTD PMID:28628672 Mmp19 Rat 4,4'-diaminodiphenylmethane increases expression ISO Mmp19 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MMP19 mRNA CTD PMID:18648102 Mmp19 Rat 4,4'-sulfonyldiphenol multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] affects the expression of MMP19 mRNA CTD PMID:28628672 Mmp19 Rat 4-hydroxyphenyl retinamide decreases expression ISO Mmp19 (Mus musculus) 6480464 Fenretinide results in decreased expression of MMP19 mRNA CTD PMID:28973697 Mmp19 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MMP19 mRNA CTD PMID:22504374 Mmp19 Rat aflatoxin B1 increases methylation ISO MMP19 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MMP19 gene CTD PMID:27153756 Mmp19 Rat aldehydo-D-glucose multiple interactions ISO Mmp19 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP19 mRNA CTD PMID:37567420 Mmp19 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MMP19 mRNA CTD PMID:30779732 Mmp19 Rat antirheumatic drug decreases expression ISO MMP19 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MMP19 mRNA CTD PMID:24449571 Mmp19 Rat aristolochic acid A increases expression ISO MMP19 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MMP19 mRNA CTD PMID:33212167 Mmp19 Rat arsane decreases expression ISO Mmp19 (Mus musculus) 6480464 Arsenic results in decreased expression of MMP19 mRNA CTD PMID:19654921 Mmp19 Rat arsane affects methylation ISO MMP19 (Homo sapiens) 6480464 Arsenic affects the methylation of MMP19 gene CTD PMID:25304211 Mmp19 Rat arsenic atom decreases expression ISO Mmp19 (Mus musculus) 6480464 Arsenic results in decreased expression of MMP19 mRNA CTD PMID:19654921 Mmp19 Rat arsenic atom affects methylation ISO MMP19 (Homo sapiens) 6480464 Arsenic affects the methylation of MMP19 gene CTD PMID:25304211 Mmp19 Rat Azoxymethane multiple interactions ISO Mmp19 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MMP19 mRNA CTD PMID:29950665 Mmp19 Rat benzo[a]pyrene increases mutagenesis ISO MMP19 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of MMP19 gene CTD PMID:25435355 Mmp19 Rat benzo[a]pyrene decreases methylation ISO MMP19 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MMP19 promoter CTD PMID:27901495 Mmp19 Rat benzo[a]pyrene increases expression ISO MMP19 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MMP19 mRNA CTD PMID:22316170 and PMID:32234424 Mmp19 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MMP19 mRNA CTD PMID:25181051 Mmp19 Rat bisphenol A increases expression ISO Mmp19 (Mus musculus) 6480464 bisphenol A results in increased expression of MMP19 mRNA CTD PMID:33221593 Mmp19 Rat bisphenol A decreases expression ISO MMP19 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MMP19 mRNA CTD PMID:29275510 Mmp19 Rat bisphenol A multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MMP19 mRNA CTD PMID:28628672 Mmp19 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of MMP19 mRNA CTD PMID:27567155 Mmp19 Rat bisphenol F multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of MMP19 mRNA CTD PMID:28628672 Mmp19 Rat bisphenol F increases expression ISO Mmp19 (Mus musculus) 6480464 bisphenol F results in increased expression of MMP19 mRNA CTD PMID:38685157 Mmp19 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of MMP19 promoter CTD PMID:22457795 Mmp19 Rat calcitriol decreases expression ISO MMP19 (Homo sapiens) 6480464 Calcitriol results in decreased expression of MMP19 mRNA CTD PMID:26485663 Mmp19 Rat carbon nanotube decreases expression ISO Mmp19 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Mmp19 Rat carbon nanotube increases expression ISO Mmp19 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mmp19 Rat chlorpyrifos increases expression ISO Mmp19 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MMP19 mRNA CTD PMID:32715474 Mmp19 Rat Chorionic gonadotropin multiple interactions ISO Mmp19 (Mus musculus) 6480464 [Gonadotropins and Equine co-treated with Chorionic Gonadotropin] results in increased expression of MMP19 mRNA CTD PMID:15831568 Mmp19 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of MMP19 mRNA CTD PMID:25596134 Mmp19 Rat D-glucose multiple interactions ISO Mmp19 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP19 mRNA CTD PMID:37567420 Mmp19 Rat decabromodiphenyl ether increases expression ISO MMP19 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of MMP19 protein CTD PMID:31675489 Mmp19 Rat dexamethasone multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MMP19 mRNA more ... CTD PMID:28628672 Mmp19 Rat dextran sulfate multiple interactions ISO Mmp19 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MMP19 mRNA CTD PMID:29950665 Mmp19 Rat dioxygen multiple interactions ISO Mmp19 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MMP19 mRNA CTD PMID:30529165 Mmp19 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MMP19 mRNA CTD PMID:29391264 Mmp19 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of MMP19 mRNA CTD PMID:25596134 Mmp19 Rat ferric oxide multiple interactions ISO Mmp19 (Mus musculus) 6480464 [Magnetite Nanoparticles co-treated with ferric oxide] results in increased expression of MMP19 mRNA CTD PMID:20540983 Mmp19 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MMP19 mRNA CTD PMID:24136188 Mmp19 Rat folic acid multiple interactions ISO Mmp19 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of MMP19 mRNA] CTD PMID:22206623 Mmp19 Rat fructose multiple interactions ISO Mmp19 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP19 mRNA CTD PMID:37567420 Mmp19 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MMP19 mRNA CTD PMID:22061828 and PMID:33387578 Mmp19 Rat glucose multiple interactions ISO Mmp19 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP19 mRNA CTD PMID:37567420 Mmp19 Rat graphene oxide increases expression ISO Mmp19 (Mus musculus) 6480464 graphene oxide results in increased expression of MMP19 mRNA CTD PMID:33227293 Mmp19 Rat hydrogen peroxide decreases expression ISO MMP19 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of MMP19 mRNA CTD PMID:18951874 Mmp19 Rat indometacin multiple interactions ISO MMP19 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MMP19 mRNA more ... CTD PMID:28628672 Mmp19 Rat lead diacetate increases expression ISO Mmp19 (Mus musculus) 6480464 lead acetate results in increased expression of MMP19 mRNA CTD PMID:22609695 Mmp19 Rat leflunomide decreases expression ISO MMP19 (Homo sapiens) 6480464 leflunomide results in decreased expression of MMP19 mRNA CTD PMID:28988120 Mmp19 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of MMP19 mRNA CTD PMID:25596134 Mmp19 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MMP19 mRNA CTD PMID:22504374 Mmp19 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of MMP19 mRNA CTD PMID:31378766 Mmp19 Rat microcystin-LR increases expression ISO Mmp19 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of MMP19 mRNA CTD PMID:37342990 Mmp19 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Mmp19 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of MMP19 mRNA CTD PMID:22401849 Mmp19 Rat nickel atom increases expression ISO MMP19 (Homo sapiens) 6480464 Nickel results in increased expression of MMP19 mRNA CTD PMID:25583101 Mmp19 Rat nitrates multiple interactions ISO Mmp19 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MMP19 mRNA CTD PMID:35964746 Mmp19 Rat paracetamol affects expression ISO Mmp19 (Mus musculus) 6480464 Acetaminophen affects the expression of MMP19 mRNA CTD PMID:17562736 Mmp19 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MMP19 mRNA CTD PMID:33387578 Mmp19 Rat paracetamol decreases expression ISO MMP19 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MMP19 mRNA CTD PMID:29067470 Mmp19 Rat perfluorohexanesulfonic acid increases expression ISO Mmp19 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MMP19 mRNA CTD PMID:37995155 Mmp19 Rat phenobarbital multiple interactions ISO Mmp19 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MMP19 mRNA] CTD PMID:19482888 Mmp19 Rat phenobarbital affects expression ISO Mmp19 (Mus musculus) 6480464 Phenobarbital affects the expression of MMP19 mRNA CTD PMID:23091169 Mmp19 Rat phenobarbital increases expression ISO Mmp19 (Mus musculus) 6480464 Phenobarbital results in increased expression of MMP19 mRNA CTD PMID:19482888 Mmp19 Rat silver atom increases expression ISO Mmp19 (Mus musculus) 6480464 Silver results in increased expression of MMP19 mRNA CTD PMID:19969064 and PMID:27131904 Mmp19 Rat silver(0) increases expression ISO Mmp19 (Mus musculus) 6480464 Silver results in increased expression of MMP19 mRNA CTD PMID:19969064 and PMID:27131904 Mmp19 Rat sodium arsenite decreases expression ISO MMP19 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MMP19 mRNA CTD PMID:29301061 Mmp19 Rat sodium arsenite decreases expression ISO Mmp19 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MMP19 mRNA CTD PMID:37682722 Mmp19 Rat sodium arsenite increases expression ISO MMP19 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MMP19 mRNA CTD PMID:38568856 Mmp19 Rat sotorasib multiple interactions ISO MMP19 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MMP19 mRNA CTD PMID:36139627 Mmp19 Rat testosterone decreases expression ISO Mmp19 (Mus musculus) 6480464 Testosterone results in decreased expression of MMP19 mRNA CTD PMID:20600201 and PMID:21669218 Mmp19 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MMP19 mRNA CTD PMID:31150632 Mmp19 Rat titanium dioxide multiple interactions ISO Mmp19 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MMP19 mRNA CTD PMID:29950665 Mmp19 Rat trametinib multiple interactions ISO MMP19 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MMP19 mRNA CTD PMID:36139627 Mmp19 Rat tremolite asbestos increases expression ISO Mmp19 (Mus musculus) 6480464 tremolite results in increased expression of MMP19 mRNA CTD PMID:29279043 Mmp19 Rat triadimefon decreases expression ISO MMP19 (Homo sapiens) 6480464 triadimefon results in decreased expression of MMP19 mRNA CTD PMID:26705709 Mmp19 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MMP19 mRNA CTD PMID:33387578 Mmp19 Rat zinc atom decreases expression ISO MMP19 (Homo sapiens) 6480464 Zinc results in decreased expression of MMP19 mRNA CTD PMID:18316168 and PMID:19071009 Mmp19 Rat zinc(0) decreases expression ISO MMP19 (Homo sapiens) 6480464 Zinc results in decreased expression of MMP19 mRNA CTD PMID:18316168 and PMID:19071009
1,1,1-trichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) bisphenol F (ISO) cadmium dichloride (EXP) calcitriol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) Chorionic gonadotropin (ISO) cyclosporin A (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dextran sulfate (ISO) dioxygen (ISO) endosulfan (EXP) fenofibrate (EXP) ferric oxide (ISO) flutamide (EXP) folic acid (ISO) fructose (ISO) gentamycin (EXP) glucose (ISO) graphene oxide (ISO) hydrogen peroxide (ISO) indometacin (ISO) lead diacetate (ISO) leflunomide (ISO) metformin (EXP) methimazole (EXP) methylmercury chloride (EXP) microcystin-LR (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel atom (ISO) nitrates (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sotorasib (ISO) testosterone (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) trametinib (ISO) tremolite asbestos (ISO) triadimefon (ISO) trichloroethene (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Matrix metalloproteinases are differentially expressed in adipose tissue during obesity and modulate adipocyte differentiation.
Chavey C, etal., J Biol Chem. 2003 Apr 4;278(14):11888-96. Epub 2003 Jan 15.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Regulation of matrix metalloproteinase-19 messenger RNA expression in the rat ovary.
Jo M and Curry TE Jr, Biol Reprod. 2004 Dec;71(6):1796-806. Epub 2004 Jul 30.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
Diet-induced obesity and reduced skin cancer susceptibility in matrix metalloproteinase 19-deficient mice.
Pendas AM, etal., Mol Cell Biol. 2004 Jun;24(12):5304-13.
7.
In vivo gene expression revealed by cDNA arrays: the pattern in relapsing-remitting multiple sclerosis patients compared with normal subjects.
Ramanathan M, etal., J Neuroimmunol. 2001 Jun 1;116(2):213-9.
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
Mmp19 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,805,732 - 1,814,054 (+) NCBI GRCr8 mRatBN7.2 7 1,221,229 - 1,229,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 1,221,343 - 1,229,555 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,984,499 - 3,992,199 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,860,160 - 5,867,860 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 6,157,051 - 6,164,751 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 3,216,392 - 3,224,202 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 3,216,497 - 3,224,201 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 3,187,758 - 3,195,773 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 2,091,532 - 2,099,235 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 2,091,513 - 2,098,874 (+) NCBI Celera 7 1,092,107 - 1,099,811 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
MMP19 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 55,835,433 - 55,842,936 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 55,835,433 - 55,842,966 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 56,229,217 - 56,236,720 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 54,515,481 - 54,523,002 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Cytogenetic Map 12 q13.2 NCBI HuRef 12 53,267,597 - 53,276,011 (-) NCBI HuRef CHM1_1 12 56,195,994 - 56,203,543 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 55,802,080 - 55,809,587 (-) NCBI T2T-CHM13v2.0
Mmp19 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 128,626,779 - 128,636,696 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 128,626,779 - 128,636,693 (+) Ensembl GRCm39 Ensembl GRCm38 10 128,790,910 - 128,800,827 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 128,790,910 - 128,800,824 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 128,227,966 - 128,237,880 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 128,193,922 - 128,202,417 (+) NCBI MGSCv36 mm8 Celera 10 131,183,125 - 131,193,039 (+) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 77.16 NCBI
Mmp19 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 3,473,279 - 3,479,620 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 3,473,279 - 3,479,620 (-) NCBI ChiLan1.0 ChiLan1.0
MMP19 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 38,485,164 - 38,492,033 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 38,481,734 - 38,488,803 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 33,068,282 - 33,075,324 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 33,794,180 - 33,801,658 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 33,794,249 - 33,801,658 (+) Ensembl panpan1.1 panPan2
MMP19 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 219,193 - 224,873 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 219,618 - 224,778 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 281,068 - 286,898 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 225,879 - 231,709 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 225,881 - 231,658 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 203,820 - 209,650 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 446,639 - 452,469 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 570,854 - 576,684 (-) NCBI UU_Cfam_GSD_1.0
Mmp19 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
MMP19 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 21,280,130 - 21,285,774 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 21,279,514 - 21,285,943 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 22,759,697 - 22,766,115 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MMP19 (Chlorocebus sabaeus - green monkey)
Mmp19 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 35 Count of miRNA genes: 35 Interacting mature miRNAs: 35 Transcripts: ENSRNOT00000008909 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
AI072476
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 1,229,339 - 1,229,553 (+) MAPPER mRatBN7.2 Rnor_6.0 7 3,224,462 - 3,224,675 NCBI Rnor6.0 Rnor_5.0 7 3,196,032 - 3,196,245 UniSTS Rnor5.0 RGSC_v3.4 7 2,099,496 - 2,099,709 UniSTS RGSC3.4 Celera 7 1,100,091 - 1,100,304 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008909 ⟹ ENSRNOP00000008909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 1,221,343 - 1,229,555 (+) Ensembl Rnor_6.0 Ensembl 7 3,216,497 - 3,224,201 (+) Ensembl
RefSeq Acc Id:
NM_001107159 ⟹ NP_001100629
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,805,875 - 1,813,578 (+) NCBI mRatBN7.2 7 1,221,373 - 1,229,075 (+) NCBI Rnor_6.0 7 3,216,497 - 3,224,200 (+) NCBI Rnor_5.0 7 3,187,758 - 3,195,773 (+) NCBI RGSC_v3.4 7 2,091,532 - 2,099,235 (+) RGD Celera 7 1,092,107 - 1,099,811 (+) RGD
Sequence:
GTCCCCTGCCTAGCCCTGTTCCTCCAAGTTCCCAGAAGTCTCAGGTCAGAGGGCTCAGGCAGCTTCTGGAACTCTTGTCTGCTGGGACCATGGACTGGCAGCAGCTGTGGCTGGCCTTCTTACTTCCT GTGACAGTCTCAGGCCGGGCTCTGGGGCCTGCAGAGAAGGAGGCGGTGGTGGATTACCTGTTGCAGTATGGGTATCTACAGAAACCTCTGGAAGGAGCTGATGACTTCAGGCTAGAAGATATCACAGA GGCTCTAAGAACTTTCCAGGAAGCATCTGAACTGCCTGTTTCCGGTCAGATGGATGATGCCACAAGGGCCCGTATGAAGCAGCCCCGTTGTGGCCTGGAGGATCCTTTCAACCAGAAGACTCTGAAAT ACCTGCTTCTGGGCCACTGGAGAAAGAAGCACTTGACATTCCGCATCTTGAACGTGCCCTCCACCCTCTCACCCTCCAGAGTCCGAGCAGCCCTGCATCAAGCCTTTAAGTATTGGAGCAATGTAGCC CCCCTGACCTTCCGGGAGGTGAAAGCTGGTTGGGCTGATATCCGCCTCTCGTTCCATGGCCGCCAAAGCCCATACTGCTCCAACAGCTTTGATGGGCCTGGGAAGGTCCTGGCCCATGCTGACGTCCC AGAGCTTGGCAGTGTACACTTCGATAACGATGAATTCTGGACCGAGGGCACCTACCAGGGAGTGAACCTACGCATCATTGCGGCCCATGAGGTGGGCCACGCCCTGGGACTTGGGCATTCCCGATATA CCCAGGCACTCATGGCGCCTGTTTACGCTGGCTACCAGCCCTACTTCAGGCTGCATCCGGATGATGTGGCAGGGATCCAGGCGCTCTATGGCAAGAGGAGGCCGGAGCCAGAAGATGAGGAGGAAGAG GTGGAGATGCACACTGTGTCAACAGTGACCACAAAACCCAGTCCCATGCCAAACCCCTGCAGCAGTGAAGTGGATGCCATGATGCTAGGGCCTCGGGGGAAGACCTATGCTTTCAAGGGTGACTATGT GTGGACTGTAACAGATTCAGGGCCAGGGCCCTTGTTCCGAGTGTCTGCCCTTTGGGAGGGGCTTCCTGGAAACCTGGATGCTGCTGTCTACTCTCCCCGGACACAGCGGACTCATTTCTTCAAGGGAA ACAAGGTGTGGCGGTATGTGGATTTCAAGTTGTCTCCTGGCTTTCCCATGAAACTCAACAGAGTGGAACCCAACCTAGATGCAGCTCTCTATTGGCCTGTTAATCAGAAGGTGTTCCTTTTTAAGGGC TCAGGATACTGGCAATGGGATGAACTGACCAGAACTGACCTCAGTCGCTACCCCAAACCAATCAAGGAACTTTTCACTGGAGTGCCAGACCAACCCTCAGCAGCTATGAGCTGGCAAGATGGCCAAGT CTACTTCTTCAAGGGCAAAGAGTACTGGCGCCTTAACCAGCAACTTCGAGTGGCAAAGGGCTATCCCAGAAATACGACACACTGGATGCACTGTAGTCCTCGGACTCCAGACACTAACTCATTAACTG GGGATGTGACCACTCCTGCAACCGTGGAATCAGTCTTGGATGTTCCCTCTGCCACAGACGCTGCCTCCCTCTCATCCTCAGCTAATGTCACCTTGCTAGGGGCCTGAGAACTAGTCAGTGTCTGCTCC TTAGGGTTGTGCAGATGGGCACTTGACCTAGTGCCCCTAGATACTCCAATTCTGGATGCCACATTCCAGTGTTCCTAGAAGGTGACTGCTTAATTCTGAGTCATTCCCCAGTCCCCATTTCTTCTTGT CATATGGCTGTTTCAAGTGTGACATCTATTTTCTGGTGGAGGGAAATTGTTGATCAGGACCCCCCCCCCCCCCAGGGTCTCTCTACATAGCACTGGCTATGGTTATCGGCTATCCTGAAACTGTGTAG TTATGTAGACTAGGCTAACTTGAACTCACAGAAACCAACCTGCCTCTGCCTCTGTCCTGAGTGCTGGGATTAAAAGCGTGTGCTAC
hide sequence
RefSeq Acc Id:
XM_006240758 ⟹ XP_006240820
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,805,732 - 1,814,054 (+) NCBI mRatBN7.2 7 1,221,229 - 1,229,555 (+) NCBI Rnor_6.0 7 3,216,392 - 3,224,202 (+) NCBI Rnor_5.0 7 3,187,758 - 3,195,773 (+) NCBI
Sequence:
TCTCTCTGGGCTGAGTCACCTCCCACTGTCCCCCAGCCCCCATTCTCTACAGTTGAAGGTTTATAAAGAGGACCAGAGGCTGACAGCAAAGACCTGGAGGATTACCTGTTGCAGTATGGGTATCTACA GAAACCTCTGGAAGGAGCTGATGACTTCAGGCTAGAAGATATCACAGAGGCTCTAAGAACTTTCCAGGAAGCATCTGAACTGCCTGTTTCCGGTCAGATGGATGATGCCACAAGGGCCCGTATGAAGC AGCCCCGTTGTGGCCTGGAGGATCCTTTCAACCAGAAGACTCTGAAATACCTGCTTCTGGGCCACTGGAGAAAGAAGCACTTGACATTCCGCATCTTGAACGTGCCCTCCACCCTCTCACCCTCCAGA GTCCGAGCAGCCCTGCATCAAGCCTTTAAGTATTGGAGCAATGTAGCCCCCCTGACCTTCCGGGAGGTGAAAGCTGGTTGGGCTGATATCCGCCTCTCGTTCCATGGCCGCCAAAGCCCATACTGCTC CAACAGCTTTGATGGGCCTGGGAAGGTCCTGGCCCATGCTGACGTCCCAGAGCTTGGCAGTGTACACTTCGATAACGATGAATTCTGGACCGAGGGCACCTACCAGGGAGTGAACCTACGCATCATTG CGGCCCATGAGGTGGGCCACGCCCTGGGACTTGGGCATTCCCGATATACCCAGGCACTCATGGCGCCTGTTTACGCTGGCTACCAGCCCTACTTCAGGCTGCATCCGGATGATGTGGCAGGGATCCAG GCGCTCTATGGCAAGAGGAGGCCGGAGCCAGAAGATGAGGAGGAAGAGGTGGAGATGCACACTGTGTCAACAGTGACCACAAAACCCAGTCCCATGCCAAACCCCTGCAGCAGTGAAGTGGATGCCAT GATGCTAGGGCCTCGGGGGAAGACCTATGCTTTCAAGGGTGACTATGTGTGGACTGTAACAGATTCAGGGCCAGGGCCCTTGTTCCGAGTGTCTGCCCTTTGGGAGGGGCTTCCTGGAAACCTGGATG CTGCTGTCTACTCTCCCCGGACACAGCGGACTCATTTCTTCAAGGGAAACAAGGTGTGGCGGTATGTGGATTTCAAGTTGTCTCCTGGCTTTCCCATGAAACTCAACAGAGTGGAACCCAACCTAGAT GCAGCTCTCTATTGGCCTGTTAATCAGAAGGTGTTCCTTTTTAAGGGCTCAGGATACTGGCAATGGGATGAACTGACCAGAACTGACCTCAGTCGCTACCCCAAACCAATCAAGGAACTTTTCACTGG AGTGCCAGACCAACCCTCAGCAGCTATGAGCTGGCAAGATGGCCAAGTCTACTTCTTCAAGGGCAAAGAGTACTGGCGCCTTAACCAGCAACTTCGAGTGGCAAAGGGCTATCCCAGAAATACGACAC ACTGGATGCACTGTAGTCCTCGGACTCCAGACACTAACTCATTAACTGGGGATGTGACCACTCCTGCAACCGTGGAATCAGTCTTGGATGTTCCCTCTGCCACAGACGCTGCCTCCCTCTCATCCTCA GCTAATGTCACCTTGCTAGGGGCCTGAGAACTAGTCAGTGTCTGCTCCTTAGGGTTGTGCAGATGGGCACTTGACCTAGTGCCCCTAGATACTCCAATTCTGGATGCCACATTCCAGTGTTCCTAGAA GGTGACTGCTTAATTCTGAGTCATTCCCCAGTCCCCATTTCTTCTTGTCATATGGCTGTTTCAAGTGTGACATCTATTTTCTGGTGGAGGGAAATTGTTGATCAGGACCCCCCCCCCCCAGGGTCTCT CTACATAGCACTGGCTATGGTTATCGGCTATCCTGAAACTGTGTAGTTATGTAGACTAGGCTAACTTGAACTCACAGAAACCAACCTGCCTCTGCCTCTGTCCTGAGTGCTGGGATTAAAAGCGTGTG CTACCA
hide sequence
RefSeq Acc Id:
XM_039078969 ⟹ XP_038934897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,805,801 - 1,814,054 (+) NCBI mRatBN7.2 7 1,221,297 - 1,229,555 (+) NCBI
RefSeq Acc Id:
NP_001100629 ⟸ NM_001107159
- Peptide Label:
precursor
- UniProtKB:
C0M4B0 (UniProtKB/TrEMBL), A6KSI7 (UniProtKB/TrEMBL), F7EUD4 (UniProtKB/TrEMBL)
- Sequence:
MDWQQLWLAFLLPVTVSGRALGPAEKEAVVDYLLQYGYLQKPLEGADDFRLEDITEALRTFQEASELPVSGQMDDATRARMKQPRCGLEDPFNQKTLKYLLLGHWRKKHLTFRILNVPSTLSPSRVRA ALHQAFKYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNSFDGPGKVLAHADVPELGSVHFDNDEFWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQPYFRLHPDDVAGIQALY GKRRPEPEDEEEEVEMHTVSTVTTKPSPMPNPCSSEVDAMMLGPRGKTYAFKGDYVWTVTDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQRTHFFKGNKVWRYVDFKLSPGFPMKLNRVEPNLDAAL YWPVNQKVFLFKGSGYWQWDELTRTDLSRYPKPIKELFTGVPDQPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCSPRTPDTNSLTGDVTTPATVESVLDVPSATDAASLSSSANV TLLGA
hide sequence
RefSeq Acc Id:
XP_006240820 ⟸ XM_006240758
- Peptide Label:
isoform X1
- Sequence:
MDDATRARMKQPRCGLEDPFNQKTLKYLLLGHWRKKHLTFRILNVPSTLSPSRVRAALHQAFKY WSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNSFDGPGKVLAHADVPELGSVHFDNDEFWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQPYFRLHPDDVAGIQALYGKRRPEPE DEEEEVEMHTVSTVTTKPSPMPNPCSSEVDAMMLGPRGKTYAFKGDYVWTVTDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQRTHFFKGNKVWRYVDFKLSPGFPMKLNRVEPNLDAALYWPVNQKV FLFKGSGYWQWDELTRTDLSRYPKPIKELFTGVPDQPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCSPRTPDTNSLTGDVTTPATVESVLDVPSATDAASLSSSANVTLLGA
hide sequence
Ensembl Acc Id:
ENSRNOP00000008909 ⟸ ENSRNOT00000008909
RefSeq Acc Id:
XP_038934897 ⟸ XM_039078969
- Peptide Label:
isoform X2
RGD ID: 13694951
Promoter ID: EPDNEW_R5476
Type: initiation region
Name: Mmp19_1
Description: matrix metallopeptidase 19
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 3,216,482 - 3,216,542 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Mmp19
matrix metallopeptidase 19
Mmp19_predicted
matrix metalloproteinase 19 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-12
Mmp19_predicted
matrix metalloproteinase 19 (predicted)
Symbol and Name status set to approved
70820
APPROVED