Symbol:
Crlf1
Name:
cytokine receptor-like factor 1
RGD ID:
1311371
Description:
Predicted to enable cytokine binding activity and cytokine receptor activity. Predicted to contribute to ciliary neurotrophic factor receptor binding activity and cytokine activity. Predicted to be involved in several processes, including cell surface receptor signaling pathway; negative regulation of motor neuron apoptotic process; and ureteric bud development. Predicted to be part of CRLF-CLCF1 complex and receptor complex. Predicted to be active in external side of plasma membrane. Human ortholog(s) of this gene implicated in cold-induced sweating syndrome 1. Orthologous to human CRLF1 (cytokine receptor like factor 1); INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC290655
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,958,695 - 18,970,026 (-) NCBI GRCr8 mRatBN7.2 16 18,924,722 - 18,936,049 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,924,722 - 18,935,997 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,966,510 - 18,977,787 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 20,099,327 - 20,110,590 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 19,019,472 - 19,030,749 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,675,042 - 20,686,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,675,042 - 20,686,317 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,530,521 - 20,541,831 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,431,472 - 19,442,747 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,431,472 - 19,442,745 (-) NCBI Celera 16 19,116,098 - 19,127,373 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Crlf1 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CRLF1 mRNA CTD PMID:27840820 Crlf1 Rat 1,2-dimethylhydrazine increases expression ISO Crlf1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CRLF1 mRNA CTD PMID:22206623 Crlf1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CRLF1 mRNA CTD PMID:30723492 Crlf1 Rat 17beta-estradiol multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of CRLF1 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of CRLF1 mRNA CTD PMID:17404688 and PMID:30165855 Crlf1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Crlf1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crlf1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO CRLF1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Crlf1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Crlf1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crlf1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CRLF1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRLF1 mRNA CTD PMID:20106945 and PMID:21632981 Crlf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CRLF1 mRNA CTD PMID:32109520 Crlf1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Crlf1 Rat 2,4-dinitrobenzenesulfonic acid increases expression ISO Crlf1 (Mus musculus) 6480464 2 and 4-dinitrobenzenesulfonic acid results in increased expression of CRLF1 mRNA CTD PMID:30116771 Crlf1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO CRLF1 (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Crlf1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Crlf1 Rat 4,4'-sulfonyldiphenol increases expression ISO Crlf1 (Mus musculus) 6480464 bisphenol S results in increased expression of CRLF1 mRNA CTD PMID:30951980 Crlf1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Crlf1 (Mus musculus) 6480464 Fenretinide results in decreased expression of CRLF1 mRNA CTD PMID:28973697 Crlf1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CRLF1 mRNA CTD PMID:24780913 Crlf1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CRLF1 mRNA CTD PMID:30047161 Crlf1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of CRLF1 mRNA CTD PMID:28959563 Crlf1 Rat acrylamide decreases expression ISO CRLF1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of CRLF1 mRNA CTD PMID:32763439 Crlf1 Rat aldehydo-D-glucose multiple interactions ISO Crlf1 (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of CRLF1 mRNA] CTD PMID:33448797 Crlf1 Rat aldehydo-D-glucose increases expression ISO Crlf1 (Mus musculus) 6480464 Glucose results in increased expression of CRLF1 mRNA CTD PMID:33448797 Crlf1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CRLF1 mRNA CTD PMID:20488242 Crlf1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CRLF1 mRNA CTD PMID:30047161 Crlf1 Rat antirheumatic drug decreases expression ISO CRLF1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CRLF1 mRNA CTD PMID:24449571 Crlf1 Rat arsane multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat arsenic atom multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat benzo[a]pyrene decreases methylation ISO CRLF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CRLF1 promoter CTD PMID:27901495 Crlf1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Crlf1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CRLF1 mRNA CTD PMID:33754040 Crlf1 Rat bisphenol A decreases expression ISO CRLF1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CRLF1 mRNA CTD PMID:23146750 and PMID:25047013 Crlf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CRLF1 mRNA CTD PMID:34947998 Crlf1 Rat bisphenol A increases expression ISO Crlf1 (Mus musculus) 6480464 bisphenol A results in increased expression of CRLF1 mRNA CTD PMID:34585602 Crlf1 Rat bisphenol A affects expression ISO CRLF1 (Homo sapiens) 6480464 bisphenol A affects the expression of CRLF1 mRNA CTD PMID:30903817 Crlf1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CRLF1 mRNA CTD PMID:25181051 Crlf1 Rat bisphenol F increases expression ISO Crlf1 (Mus musculus) 6480464 bisphenol F results in increased expression of CRLF1 mRNA CTD PMID:30951980 Crlf1 Rat butanal increases expression ISO CRLF1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of CRLF1 mRNA CTD PMID:26079696 Crlf1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of CRLF1 mRNA CTD PMID:19167457 Crlf1 Rat cadmium atom multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CRLF1 mRNA CTD PMID:31738976 Crlf1 Rat cadmium dichloride multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CRLF1 mRNA CTD PMID:31738976 Crlf1 Rat cadmium dichloride decreases expression ISO CRLF1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CRLF1 mRNA CTD PMID:38382870 Crlf1 Rat calcitriol increases expression ISO CRLF1 (Homo sapiens) 6480464 Calcitriol results in increased expression of CRLF1 mRNA CTD PMID:26485663 Crlf1 Rat CGP 52608 multiple interactions ISO CRLF1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CRLF1 gene] CTD PMID:28238834 Crlf1 Rat chlorpyrifos increases expression ISO Crlf1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CRLF1 mRNA CTD PMID:37019170 Crlf1 Rat choline multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CRLF1 gene CTD PMID:20938992 Crlf1 Rat cisplatin multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CRLF1 mRNA CTD PMID:27392435 Crlf1 Rat cisplatin increases expression ISO CRLF1 (Homo sapiens) 6480464 Cisplatin results in increased expression of CRLF1 mRNA CTD PMID:27392435 Crlf1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CRLF1 mRNA CTD PMID:26577399 Crlf1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of CRLF1 mRNA CTD PMID:22528246 Crlf1 Rat D-glucose multiple interactions ISO Crlf1 (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of CRLF1 mRNA] CTD PMID:33448797 Crlf1 Rat D-glucose increases expression ISO Crlf1 (Mus musculus) 6480464 Glucose results in increased expression of CRLF1 mRNA CTD PMID:33448797 Crlf1 Rat DDE decreases expression ISO CRLF1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CRLF1 mRNA CTD PMID:38568856 Crlf1 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of CRLF1 mRNA CTD PMID:29108742 Crlf1 Rat dorsomorphin multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRLF1 mRNA CTD PMID:27188386 Crlf1 Rat doxorubicin increases expression ISO CRLF1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of CRLF1 mRNA CTD PMID:29803840 Crlf1 Rat entinostat increases expression ISO CRLF1 (Homo sapiens) 6480464 entinostat results in increased expression of CRLF1 mRNA CTD PMID:26272509 and PMID:27188386 Crlf1 Rat entinostat multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRLF1 mRNA CTD PMID:27188386 Crlf1 Rat fentanyl affects expression EXP 6480464 Fentanyl affects the expression of CRLF1 mRNA CTD PMID:36032789 Crlf1 Rat folic acid multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CRLF1 gene CTD PMID:20938992 Crlf1 Rat fucoxanthin multiple interactions ISO Crlf1 (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of CRLF1 mRNA] CTD PMID:33448797 Crlf1 Rat furan increases expression EXP 6480464 furan results in increased expression of CRLF1 mRNA CTD PMID:27387713 Crlf1 Rat glucose increases expression ISO Crlf1 (Mus musculus) 6480464 Glucose results in increased expression of CRLF1 mRNA CTD PMID:33448797 Crlf1 Rat glucose multiple interactions ISO Crlf1 (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in increased expression of CRLF1 mRNA] CTD PMID:33448797 Crlf1 Rat isoprenaline increases expression ISO Crlf1 (Mus musculus) 6480464 Isoproterenol results in increased expression of CRLF1 mRNA CTD PMID:20003209 Crlf1 Rat L-methionine multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CRLF1 gene CTD PMID:20938992 Crlf1 Rat maneb multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of CRLF1 mRNA CTD PMID:36117858 Crlf1 Rat manganese atom multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat manganese(0) multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat manganese(II) chloride multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of CRLF1 mRNA CTD PMID:30047161 Crlf1 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of CRLF1 mRNA CTD PMID:31378766 Crlf1 Rat miconazole decreases expression ISO Crlf1 (Mus musculus) 6480464 Miconazole results in decreased expression of CRLF1 mRNA CTD PMID:27462272 Crlf1 Rat niclosamide decreases expression ISO CRLF1 (Homo sapiens) 6480464 Niclosamide results in decreased expression of CRLF1 mRNA CTD PMID:36318118 Crlf1 Rat ochratoxin A increases expression ISO CRLF1 (Homo sapiens) 6480464 ochratoxin A results in increased expression of CRLF1 mRNA CTD PMID:29098329 Crlf1 Rat ochratoxin A increases acetylation ISO CRLF1 (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of CRLF1 promoter CTD PMID:29098329 Crlf1 Rat ochratoxin A multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of CRLF1 promoter] which results in increased expression of CRLF1 mRNA CTD PMID:29098329 Crlf1 Rat ozone multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CRLF1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CRLF1 mRNA CTD PMID:34911549 Crlf1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CRLF1 mRNA CTD PMID:33387578 Crlf1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of CRLF1 mRNA CTD PMID:32680482 Crlf1 Rat paraquat multiple interactions ISO Crlf1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of CRLF1 mRNA CTD PMID:36117858 Crlf1 Rat PCB138 multiple interactions ISO Crlf1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crlf1 Rat pentanal increases expression ISO CRLF1 (Homo sapiens) 6480464 pentanal results in increased expression of CRLF1 mRNA CTD PMID:26079696 Crlf1 Rat perfluorooctanoic acid decreases expression ISO CRLF1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of CRLF1 mRNA CTD PMID:23146750 Crlf1 Rat progesterone multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of CRLF1 mRNA CTD PMID:17404688 Crlf1 Rat progesterone increases expression ISO Crlf1 (Mus musculus) 6480464 Progesterone results in increased expression of CRLF1 mRNA CTD PMID:19693291 Crlf1 Rat progesterone increases expression ISO CRLF1 (Homo sapiens) 6480464 Progesterone results in increased expression of CRLF1 mRNA CTD PMID:17404688 Crlf1 Rat propanal increases expression ISO CRLF1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CRLF1 mRNA CTD PMID:26079696 Crlf1 Rat quercetin decreases expression ISO CRLF1 (Homo sapiens) 6480464 Quercetin results in decreased expression of CRLF1 mRNA CTD PMID:21632981 Crlf1 Rat resveratrol multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CRLF1 mRNA CTD PMID:23557933 Crlf1 Rat SB 431542 multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRLF1 mRNA CTD PMID:27188386 Crlf1 Rat sodium arsenite multiple interactions ISO CRLF1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of CRLF1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CRLF1 mRNA CTD PMID:39836092 Crlf1 Rat sodium arsenite increases expression ISO Crlf1 (Mus musculus) 6480464 sodium arsenite results in increased expression of CRLF1 mRNA CTD PMID:37682722 Crlf1 Rat testosterone increases expression ISO Crlf1 (Mus musculus) 6480464 Testosterone results in increased expression of CRLF1 mRNA CTD PMID:19693291 Crlf1 Rat tetrachloromethane increases expression ISO Crlf1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CRLF1 mRNA CTD PMID:17484886 Crlf1 Rat titanium dioxide decreases expression ISO Crlf1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CRLF1 mRNA CTD PMID:29264374 Crlf1 Rat titanium dioxide increases methylation ISO Crlf1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CRLF1 gene CTD PMID:35295148 Crlf1 Rat titanium dioxide decreases methylation ISO Crlf1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CRLF1 gene CTD PMID:35295148 Crlf1 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of CRLF1 mRNA CTD PMID:21683754 Crlf1 Rat triphenyl phosphate affects expression ISO CRLF1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CRLF1 mRNA CTD PMID:37042841 Crlf1 Rat triptonide increases expression ISO Crlf1 (Mus musculus) 6480464 triptonide results in increased expression of CRLF1 mRNA CTD PMID:33045310 Crlf1 Rat valproic acid affects expression ISO Crlf1 (Mus musculus) 6480464 Valproic Acid affects the expression of CRLF1 mRNA CTD PMID:17292431 Crlf1 Rat valproic acid increases expression ISO CRLF1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CRLF1 mRNA CTD PMID:23179753 more ... Crlf1 Rat valproic acid affects expression ISO CRLF1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CRLF1 mRNA CTD PMID:25979313 Crlf1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CRLF1 mRNA CTD PMID:19015723
1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrobenzenesulfonic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) amitrole (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) Cuprizon (EXP) cypermethrin (EXP) D-glucose (ISO) DDE (ISO) diazinon (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) fentanyl (EXP) folic acid (ISO) fucoxanthin (ISO) furan (EXP) glucose (ISO) isoprenaline (ISO) L-methionine (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methylmercury chloride (EXP) miconazole (ISO) niclosamide (ISO) ochratoxin A (ISO) ozone (ISO) paracetamol (EXP) paraquat (EXP,ISO) PCB138 (ISO) pentanal (ISO) perfluorooctanoic acid (ISO) progesterone (ISO) propanal (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) testosterone (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) tributylstannane (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Crlf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,958,695 - 18,970,026 (-) NCBI GRCr8 mRatBN7.2 16 18,924,722 - 18,936,049 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,924,722 - 18,935,997 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,966,510 - 18,977,787 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 20,099,327 - 20,110,590 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 19,019,472 - 19,030,749 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,675,042 - 20,686,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,675,042 - 20,686,317 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,530,521 - 20,541,831 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,431,472 - 19,442,747 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,431,472 - 19,442,745 (-) NCBI Celera 16 19,116,098 - 19,127,373 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
CRLF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 18,593,237 - 18,606,799 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 18,572,220 - 18,607,741 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 18,704,047 - 18,717,609 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 18,565,047 - 18,578,660 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 18,565,046 - 18,578,660 NCBI Celera 19 18,606,237 - 18,619,858 (-) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 18,266,624 - 18,309,213 (-) NCBI HuRef CHM1_1 19 18,704,266 - 18,717,662 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 18,728,303 - 18,741,874 (-) NCBI T2T-CHM13v2.0
Crlf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 70,945,798 - 70,956,728 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 70,945,808 - 70,956,731 (+) Ensembl GRCm39 Ensembl GRCm38 8 70,493,097 - 70,504,078 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,493,158 - 70,504,081 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,017,055 - 73,027,980 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,422,145 - 73,433,070 (+) NCBI MGSCv36 mm8 Celera 8 73,049,567 - 73,060,492 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.15 NCBI
Crlf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955524 2,998,260 - 3,003,283 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955524 2,998,258 - 3,003,553 (+) NCBI ChiLan1.0 ChiLan1.0
CRLF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 23,452,262 - 23,465,525 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 22,460,674 - 22,473,911 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 18,070,465 - 18,083,701 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 19,040,355 - 19,048,927 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 19,040,682 - 19,046,584 (-) Ensembl panpan1.1 panPan2
CRLF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 44,466,812 - 44,476,055 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 44,466,810 - 44,472,637 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,376,895 - 44,389,992 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 44,948,405 - 44,961,499 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 44,948,246 - 44,958,835 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,185,771 - 44,198,860 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 44,595,729 - 44,608,819 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 44,871,168 - 44,884,262 (+) NCBI UU_Cfam_GSD_1.0
Crlf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,147,220 - 203,153,304 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 2,693,881 - 2,702,131 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 2,693,881 - 2,702,443 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CRLF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 59,222,367 - 59,233,720 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 59,222,551 - 59,233,723 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 59,069,084 - 59,075,048 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CRLF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 17,061,289 - 17,074,930 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 17,061,621 - 17,074,794 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 2,261,781 - 2,275,479 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crlf1
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 35 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000060097 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
RH128982
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,924,775 - 18,924,931 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,675,096 - 20,675,251 NCBI Rnor6.0 Rnor_5.0 16 20,530,575 - 20,530,730 UniSTS Rnor5.0 RGSC_v3.4 16 19,431,526 - 19,431,681 UniSTS RGSC3.4 Celera 16 19,116,152 - 19,116,307 UniSTS RH 3.4 Map 16 214.42 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
63
62
31
24
31
6
187
94
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000060097 ⟹ ENSRNOP00000056846
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,924,722 - 18,935,997 (-) Ensembl Rnor_6.0 Ensembl 16 20,675,042 - 20,686,317 (-) Ensembl
RefSeq Acc Id:
NM_001106074 ⟹ NP_001099544
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,958,695 - 18,969,970 (-) NCBI mRatBN7.2 16 18,924,722 - 18,935,997 (-) NCBI Rnor_6.0 16 20,675,042 - 20,686,317 (-) NCBI Rnor_5.0 16 20,530,521 - 20,541,831 (-) NCBI RGSC_v3.4 16 19,431,472 - 19,442,747 (-) RGD Celera 16 19,116,098 - 19,127,373 (-) RGD
Sequence:
TCCGGCCTTCGCTGTCCGCGCCCAGTGACGTGCGTGCGGACCCAAACCCCAATCTGCACCCCGCAGAGTCGCCCCCGCCCCATACCGGCGTTGCAGTCACCGCCCGTTGCGCGCCACCCCCATGCCCG
hide sequence
RefSeq Acc Id:
XM_006252872 ⟹ XP_006252934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,958,706 - 18,970,024 (-) NCBI mRatBN7.2 16 18,924,733 - 18,936,047 (-) NCBI Rnor_6.0 16 20,675,052 - 20,686,365 (-) NCBI Rnor_5.0 16 20,530,521 - 20,541,831 (-) NCBI
Sequence:
GGCGAGCGGCGCATTAGCGCCTTGTCAATTTCGGCTGCTCAGACTTGCTCCGGCCTTCGCTGTC
hide sequence
RefSeq Acc Id:
XM_006252874 ⟹ XP_006252936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,958,706 - 18,970,024 (-) NCBI mRatBN7.2 16 18,924,733 - 18,936,048 (-) NCBI Rnor_6.0 16 20,675,052 - 20,686,365 (-) NCBI Rnor_5.0 16 20,530,521 - 20,541,831 (-) NCBI
Sequence:
GGCGAGCGGCGCATTAGCGCCTTGTCAATTTCGGCTGCTCAGACTTGCTCCGGCCTTCGCTGTCCGCGCCCAGTGACGTGCGTGCGGACCCAAACCCCAATCTGCACCCCGCAGAGTCGCCCCCGCCC
hide sequence
RefSeq Acc Id:
XM_039094330 ⟹ XP_038950258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,958,706 - 18,970,026 (-) NCBI mRatBN7.2 16 18,924,733 - 18,936,049 (-) NCBI
RefSeq Acc Id:
XM_039094331 ⟹ XP_038950259
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,958,706 - 18,970,025 (-) NCBI mRatBN7.2 16 18,924,733 - 18,936,048 (-) NCBI
RefSeq Acc Id:
XM_039094332 ⟹ XP_038950260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,960,134 - 18,970,026 (-) NCBI mRatBN7.2 16 18,926,161 - 18,936,049 (-) NCBI
RefSeq Acc Id:
NP_001099544 ⟸ NM_001106074
- Peptide Label:
precursor
- UniProtKB:
A6KA48 (UniProtKB/TrEMBL)
- Sequence:
MPAGGPGPAAQSARRPPRRLSSLWSPLLLCVLGVPQGGSGAHTAVISPQDPTLLIGSSLHATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILA
hide sequence
RefSeq Acc Id:
XP_006252934 ⟸ XM_006252872
- Peptide Label:
isoform X3
- UniProtKB:
D3ZIV9 (UniProtKB/TrEMBL)
- Sequence:
MPAGGPGPAAQSARRPPRRLSSLWSPLLLCVLGVPQGGSGAHTAVISPQDPTLLIGSSLHATCS
hide sequence
RefSeq Acc Id:
XP_006252936 ⟸ XM_006252874
- Peptide Label:
isoform X4
- Sequence:
MPAGGPGPAAQSARRPPRRLSSLWSPLLLCVLGVPQGGSGAHTAVISPQDPTLLIGSSLHATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILA
hide sequence
Ensembl Acc Id:
ENSRNOP00000056846 ⟸ ENSRNOT00000060097
RefSeq Acc Id:
XP_038950258 ⟸ XM_039094330
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038950259 ⟸ XM_039094331
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038950260 ⟸ XM_039094332
- Peptide Label:
isoform X5
RGD ID: 13700031 Promoter ID: EPDNEW_R10553 Type: multiple initiation site Name: Crlf1_1 Description: cytokine receptor-like factor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 20,686,325 - 20,686,385 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Crlf1
cytokine receptor-like factor 1
Crlf1_predicted
cytokine receptor-like factor 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Crlf1_predicted
cytokine receptor-like factor 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
