Symbol:
Frzb
Name:
frizzled-related protein
RGD ID:
1311315
Description:
Predicted to enable Wnt-protein binding activity. Predicted to be involved in several processes, including negative regulation of cell growth; neural crest cell differentiation; and somite development. Predicted to act upstream of or within several processes, including cochlea morphogenesis; negative regulation of canonical Wnt signaling pathway; and negative regulation of cell differentiation. Predicted to be located in extracellular region. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma and osteoarthritis. Orthologous to human FRZB (frizzled related protein); PARTICIPATES IN Wnt signaling, canonical pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC295691; secreted frizzled-related protein 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 85,739,162 - 85,772,168 (-) NCBI GRCr8 mRatBN7.2 3 65,332,274 - 65,365,208 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 65,332,277 - 65,365,208 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 68,678,473 - 68,711,328 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 77,262,043 - 77,294,902 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 75,024,919 - 75,057,671 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 67,635,604 - 67,668,772 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 67,635,607 - 67,668,772 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 74,196,163 - 74,229,331 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 63,350,504 - 63,383,436 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 63,246,875 - 63,295,070 (-) NCBI Celera 3 64,780,097 - 64,813,027 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Frzb Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of FRZB mRNA CTD PMID:27840820 Frzb Rat 1,2-dimethylhydrazine increases expression ISO Frzb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FRZB mRNA CTD PMID:22206623 Frzb Rat 17alpha-ethynylestradiol affects expression ISO FRZB (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of FRZB mRNA CTD PMID:26865667 Frzb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Frzb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FRZB mRNA CTD PMID:19933214 Frzb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FRZB mRNA CTD PMID:34747641 Frzb Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Frzb (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Frzb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FRZB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of FRZB mRNA CTD PMID:28628672 Frzb Rat 4,4'-diaminodiphenylmethane increases expression ISO Frzb (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of FRZB mRNA CTD PMID:18648102 Frzb Rat 5-aza-2'-deoxycytidine decreases expression ISO Frzb (Mus musculus) 6480464 Decitabine results in decreased expression of FRZB mRNA CTD PMID:27915011 Frzb Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FRZB mRNA CTD PMID:24780913 Frzb Rat actinomycin D multiple interactions ISO FRZB (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of FRZB mRNA CTD PMID:38460933 Frzb Rat aflatoxin B1 increases expression ISO FRZB (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of FRZB mRNA CTD PMID:21641981 and PMID:22100608 Frzb Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of FRZB mRNA CTD PMID:33354967 Frzb Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of FRZB mRNA CTD PMID:20488242 Frzb Rat all-trans-retinoic acid decreases expression ISO FRZB (Homo sapiens) 6480464 Tretinoin results in decreased expression of FRZB mRNA CTD PMID:21934132 and PMID:23724009 Frzb Rat aristolochic acid A increases expression ISO FRZB (Homo sapiens) 6480464 aristolochic acid I results in increased expression of FRZB mRNA CTD PMID:33212167 Frzb Rat arsane affects expression ISO FRZB (Homo sapiens) 6480464 Arsenic affects the expression of FRZB protein CTD PMID:24675094 Frzb Rat arsenic atom affects expression ISO FRZB (Homo sapiens) 6480464 Arsenic affects the expression of FRZB protein CTD PMID:24675094 Frzb Rat atrazine multiple interactions ISO FRZB (Homo sapiens) 6480464 [Atrazine co-treated with Arsenates] results in increased expression of FRZB mRNA CTD PMID:18585445 Frzb Rat benzo[a]pyrene increases expression ISO FRZB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of FRZB mRNA CTD PMID:22316170 Frzb Rat benzo[a]pyrene decreases methylation ISO FRZB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of FRZB 3' UTR and Benzo(a)pyrene results in decreased methylation of FRZB promoter CTD PMID:27901495 Frzb Rat benzo[a]pyrene increases methylation ISO FRZB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FRZB 5' UTR CTD PMID:27901495 Frzb Rat benzo[a]pyrene increases expression ISO Frzb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FRZB mRNA CTD PMID:22228805 and PMID:32417428 Frzb Rat benzylpenicillin decreases expression ISO FRZB (Homo sapiens) 6480464 Penicillin G results in decreased expression of FRZB mRNA CTD PMID:24737281 Frzb Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of FRZB mRNA CTD PMID:18164116 Frzb Rat beta-naphthoflavone decreases expression ISO FRZB (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of FRZB mRNA CTD PMID:32858204 Frzb Rat bis(2-ethylhexyl) phthalate decreases expression ISO FRZB (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of FRZB mRNA CTD PMID:31163220 Frzb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FRZB mRNA CTD PMID:25181051 Frzb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FRZB mRNA CTD PMID:36779543 Frzb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FRZB mRNA CTD PMID:30816183 more ... Frzb Rat bisphenol A increases expression ISO Frzb (Mus musculus) 6480464 bisphenol A results in increased expression of FRZB mRNA CTD PMID:25594700 Frzb Rat butanal increases expression ISO FRZB (Homo sapiens) 6480464 butyraldehyde results in increased expression of FRZB mRNA CTD PMID:26079696 Frzb Rat cadmium atom multiple interactions ISO FRZB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FRZB mRNA CTD PMID:35301059 Frzb Rat cadmium dichloride multiple interactions ISO FRZB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FRZB mRNA CTD PMID:35301059 Frzb Rat camptothecin increases expression ISO FRZB (Homo sapiens) 6480464 Camptothecin results in increased expression of FRZB mRNA CTD PMID:38460933 Frzb Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of FRZB mRNA CTD PMID:30744511 Frzb Rat choline multiple interactions ISO Frzb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FRZB mRNA CTD PMID:20938992 Frzb Rat cisplatin increases expression ISO FRZB (Homo sapiens) 6480464 Cisplatin results in increased expression of FRZB mRNA CTD PMID:27392435 Frzb Rat clobetasol increases expression ISO Frzb (Mus musculus) 6480464 Clobetasol results in increased expression of FRZB mRNA CTD PMID:27462272 Frzb Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of FRZB mRNA CTD PMID:30556269 Frzb Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of FRZB mRNA CTD PMID:30556269 Frzb Rat copper(II) sulfate decreases expression ISO FRZB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of FRZB mRNA CTD PMID:19549813 Frzb Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of FRZB mRNA CTD PMID:26577399 Frzb Rat cytarabine decreases expression ISO FRZB (Homo sapiens) 6480464 Cytarabine results in decreased expression of FRZB mRNA CTD PMID:21198554 Frzb Rat deguelin increases expression ISO FRZB (Homo sapiens) 6480464 deguelin results in increased expression of FRZB mRNA CTD PMID:19861542 Frzb Rat dexamethasone increases expression ISO FRZB (Homo sapiens) 6480464 Dexamethasone results in increased expression of FRZB mRNA CTD PMID:25047013 Frzb Rat dexamethasone multiple interactions ISO FRZB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of FRZB mRNA CTD PMID:28628672 Frzb Rat diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of FRZB mRNA CTD PMID:34014027 Frzb Rat diethylstilbestrol increases expression ISO Frzb (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of FRZB mRNA CTD PMID:15591538 Frzb Rat dioxygen decreases expression ISO FRZB (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of FRZB mRNA CTD PMID:24236059 Frzb Rat diquat decreases expression ISO Frzb (Mus musculus) 6480464 Diquat results in decreased expression of FRZB mRNA CTD PMID:36851058 Frzb Rat dorsomorphin multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Frzb Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of FRZB mRNA CTD PMID:32289291 Frzb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of FRZB mRNA CTD PMID:29391264 Frzb Rat ethanol affects splicing ISO Frzb (Mus musculus) 6480464 Ethanol affects the splicing of FRZB mRNA CTD PMID:30319688 Frzb Rat ethanol decreases expression ISO Frzb (Mus musculus) 6480464 Ethanol results in decreased expression of FRZB mRNA CTD PMID:34755883 Frzb Rat ethanol affects expression ISO Frzb (Mus musculus) 6480464 Ethanol affects the expression of FRZB mRNA CTD PMID:30319688 Frzb Rat folic acid multiple interactions ISO Frzb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FRZB mRNA CTD PMID:20938992 Frzb Rat folic acid decreases expression ISO FRZB (Homo sapiens) 6480464 Folic Acid results in decreased expression of FRZB mRNA CTD PMID:21867686 Frzb Rat furan increases expression EXP 6480464 furan results in increased expression of FRZB mRNA CTD PMID:27387713 Frzb Rat genistein decreases expression ISO FRZB (Homo sapiens) 6480464 Genistein results in decreased expression of FRZB mRNA CTD PMID:26865667 Frzb Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of FRZB mRNA CTD PMID:24395379 Frzb Rat GW 4064 decreases expression ISO Frzb (Mus musculus) 6480464 GW 4064 results in decreased expression of FRZB mRNA CTD PMID:26655953 Frzb Rat ibuprofen affects expression ISO FRZB (Homo sapiens) 6480464 Ibuprofen affects the expression of FRZB mRNA CTD PMID:17070997 Frzb Rat indometacin multiple interactions ISO FRZB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of FRZB mRNA CTD PMID:28628672 Frzb Rat L-methionine multiple interactions ISO Frzb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FRZB mRNA CTD PMID:20938992 Frzb Rat lead(0) decreases expression ISO FRZB (Homo sapiens) 6480464 Lead results in decreased expression of FRZB mRNA CTD PMID:19921347 Frzb Rat Licochalcone B increases expression ISO FRZB (Homo sapiens) 6480464 licochalcone B results in increased expression of FRZB mRNA CTD PMID:33647349 Frzb Rat lipopolysaccharide decreases expression ISO FRZB (Homo sapiens) 32716394 Lipopolysaccharide decreases expression of Frzb mRNA in cells of skeletal muscle RGD Frzb Rat mercury dibromide multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FRZB gene CTD PMID:35440735 Frzb Rat methylmercury chloride decreases expression ISO FRZB (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of FRZB mRNA CTD PMID:23179753 and PMID:28001369 Frzb Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of FRZB mRNA CTD PMID:30744511 Frzb Rat Monobutylphthalate affects expression ISO Frzb (Mus musculus) 6480464 monobutyl phthalate affects the expression of FRZB mRNA CTD PMID:19162170 Frzb Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of FRZB mRNA CTD PMID:18164116 Frzb Rat nickel atom decreases expression ISO FRZB (Homo sapiens) 6480464 Nickel results in decreased expression of FRZB mRNA CTD PMID:24768652 and PMID:25583101 Frzb Rat nickel subsulfide decreases expression EXP 6480464 nickel subsulfide results in decreased expression of FRZB mRNA CTD PMID:24952340 Frzb Rat niclosamide increases expression ISO FRZB (Homo sapiens) 6480464 Niclosamide results in increased expression of FRZB mRNA CTD PMID:36318118 Frzb Rat Nutlin-3 multiple interactions ISO FRZB (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of FRZB mRNA CTD PMID:38460933 Frzb Rat ochratoxin A increases expression ISO FRZB (Homo sapiens) 6480464 ochratoxin A results in increased expression of FRZB mRNA CTD PMID:22124623 Frzb Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of FRZB mRNA CTD PMID:22124623 Frzb Rat oxybenzone decreases expression EXP 6480464 oxybenzone results in decreased expression of FRZB mRNA CTD PMID:30316929 Frzb Rat p-chloromercuribenzoic acid decreases expression ISO FRZB (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of FRZB mRNA CTD PMID:26272509 Frzb Rat p-chloromercuribenzoic acid multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat panobinostat multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat panobinostat decreases expression ISO FRZB (Homo sapiens) 6480464 panobinostat results in decreased expression of FRZB mRNA CTD PMID:26272509 Frzb Rat paracetamol affects expression ISO Frzb (Mus musculus) 6480464 Acetaminophen affects the expression of FRZB mRNA CTD PMID:17562736 Frzb Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of FRZB mRNA CTD PMID:32680482 Frzb Rat perfluorohexanesulfonic acid increases expression ISO Frzb (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of FRZB mRNA CTD PMID:37995155 Frzb Rat phenylmercury acetate decreases expression ISO FRZB (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of FRZB mRNA CTD PMID:26272509 Frzb Rat phenylmercury acetate multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat pioglitazone multiple interactions ISO Frzb (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of FRZB mRNA CTD PMID:27935865 Frzb Rat progesterone decreases expression ISO Frzb (Mus musculus) 6480464 Progesterone results in decreased expression of FRZB mRNA CTD PMID:19693291 Frzb Rat propanal increases expression ISO FRZB (Homo sapiens) 6480464 propionaldehyde results in increased expression of FRZB mRNA CTD PMID:26079696 Frzb Rat quercetin increases expression ISO FRZB (Homo sapiens) 6480464 Quercetin results in increased expression of FRZB mRNA CTD PMID:21632981 Frzb Rat retinyl acetate increases expression ISO Frzb (Mus musculus) 6480464 retinol acetate results in increased expression of FRZB mRNA CTD PMID:16772331 Frzb Rat rofecoxib affects expression ISO FRZB (Homo sapiens) 6480464 rofecoxib affects the expression of FRZB mRNA CTD PMID:17070997 Frzb Rat rotenone increases expression ISO Frzb (Mus musculus) 6480464 Rotenone results in increased expression of FRZB mRNA CTD PMID:32937126 Frzb Rat SB 431542 multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Frzb Rat silicon dioxide increases expression ISO Frzb (Mus musculus) 6480464 Silicon Dioxide results in increased expression of FRZB mRNA CTD PMID:23221170 Frzb Rat sodium arsenite affects methylation ISO FRZB (Homo sapiens) 6480464 sodium arsenite affects the methylation of FRZB gene CTD PMID:28589171 Frzb Rat sunitinib decreases expression ISO FRZB (Homo sapiens) 6480464 Sunitinib results in decreased expression of FRZB mRNA CTD PMID:31533062 Frzb Rat tamoxifen increases expression ISO Frzb (Mus musculus) 6480464 Tamoxifen results in increased expression of FRZB mRNA CTD PMID:25123088 Frzb Rat testosterone decreases expression ISO Frzb (Mus musculus) 6480464 Testosterone results in decreased expression of FRZB mRNA CTD PMID:19693291 Frzb Rat testosterone enanthate affects expression ISO FRZB (Homo sapiens) 6480464 testosterone enanthate affects the expression of FRZB mRNA CTD PMID:17440010 Frzb Rat tetrachloroethene decreases expression ISO Frzb (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of FRZB mRNA CTD PMID:28973375 Frzb Rat Theaflavin 3,3'-digallate affects expression ISO FRZB (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of FRZB mRNA CTD PMID:34925699 Frzb Rat titanium dioxide decreases methylation ISO Frzb (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FRZB gene and titanium dioxide results in decreased methylation of FRZB promoter CTD PMID:35295148 Frzb Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of FRZB gene CTD PMID:27618143 Frzb Rat trichostatin A decreases expression ISO FRZB (Homo sapiens) 6480464 trichostatin A results in decreased expression of FRZB mRNA CTD PMID:24935251 and PMID:26272509 Frzb Rat trichostatin A increases expression ISO FRZB (Homo sapiens) 32716395 Trichostatin A increases expression of Frzb mRNA in adenocarcinoma cells RGD Frzb Rat trichostatin A multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat triclosan increases expression ISO FRZB (Homo sapiens) 6480464 Triclosan results in increased expression of FRZB mRNA CTD PMID:30510588 Frzb Rat trimellitic anhydride increases expression ISO Frzb (Mus musculus) 6480464 trimellitic anhydride results in increased expression of FRZB mRNA CTD PMID:19042947 Frzb Rat tunicamycin decreases expression ISO FRZB (Homo sapiens) 6480464 Tunicamycin results in decreased expression of FRZB mRNA CTD PMID:22378314 Frzb Rat valproic acid increases expression ISO FRZB (Homo sapiens) 6480464 Valproic Acid results in increased expression of FRZB mRNA CTD PMID:19101580 Frzb Rat valproic acid affects expression ISO Frzb (Mus musculus) 6480464 Valproic Acid affects the expression of FRZB mRNA CTD PMID:17963808 Frzb Rat valproic acid increases expression ISO Frzb (Mus musculus) 6480464 Valproic Acid results in increased expression of FRZB mRNA CTD PMID:24896083 Frzb Rat valproic acid decreases expression ISO FRZB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FRZB mRNA CTD PMID:24383497 more ... Frzb Rat valproic acid multiple interactions ISO FRZB (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FRZB mRNA CTD PMID:27188386 Frzb Rat vorinostat decreases expression ISO FRZB (Homo sapiens) 6480464 vorinostat results in decreased expression of FRZB mRNA CTD PMID:26272509 Frzb Rat XL147 multiple interactions ISO Frzb (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of FRZB mRNA CTD PMID:27935865
1,2-dimethylhydrazine (EXP,ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP,ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzylpenicillin (ISO) beta-naphthoflavone (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) camptothecin (ISO) chlorohydrocarbon (EXP) choline (ISO) cisplatin (ISO) clobetasol (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cytarabine (ISO) deguelin (ISO) dexamethasone (ISO) diallyl trisulfide (EXP) diethylstilbestrol (ISO) dioxygen (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (EXP) endosulfan (EXP) ethanol (ISO) folic acid (ISO) furan (EXP) genistein (ISO) glycidol (EXP) GW 4064 (ISO) ibuprofen (ISO) indometacin (ISO) L-methionine (ISO) lead(0) (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methoxychlor (EXP) methylmercury chloride (EXP,ISO) Monobutylphthalate (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nickel subsulfide (EXP) niclosamide (ISO) Nutlin-3 (ISO) ochratoxin A (EXP,ISO) oxybenzone (EXP) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) progesterone (ISO) propanal (ISO) quercetin (ISO) retinyl acetate (ISO) rofecoxib (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO) XL147 (ISO)
Biological Process
biological_process (ND) cell differentiation (IEA) cochlea morphogenesis (IEA,ISO) convergent extension involved in organogenesis (IEA,ISO) developmental process (IEA) epithelial cell development (IEA,ISO) hepatocyte differentiation (IEA,ISO) inner ear morphogenesis (IEA,ISO) negative regulation of canonical Wnt signaling pathway (IEA,ISO) negative regulation of cartilage development (IEA,ISO) negative regulation of cell development (IEA,ISO) negative regulation of cell growth (IEA,ISO) negative regulation of cell population proliferation (IEA,ISO) negative regulation of hepatocyte differentiation (IEA,ISO) negative regulation of Wnt signaling pathway (IEA,ISO) neural crest cell differentiation (IEA,ISO) positive regulation of apoptotic process (IEA,ISO) positive regulation of fat cell differentiation (IEA,ISO) somite development (IEA,ISO) Wnt signaling pathway (IEA)
Frzb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 85,739,162 - 85,772,168 (-) NCBI GRCr8 mRatBN7.2 3 65,332,274 - 65,365,208 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 65,332,277 - 65,365,208 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 68,678,473 - 68,711,328 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 77,262,043 - 77,294,902 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 75,024,919 - 75,057,671 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 67,635,604 - 67,668,772 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 67,635,607 - 67,668,772 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 74,196,163 - 74,229,331 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 63,350,504 - 63,383,436 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 63,246,875 - 63,295,070 (-) NCBI Celera 3 64,780,097 - 64,813,027 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI
FRZB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 182,833,275 - 182,866,637 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 182,833,275 - 182,866,637 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 183,698,002 - 183,731,365 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 183,406,982 - 183,439,743 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 183,524,242 - 183,557,004 NCBI Celera 2 177,294,242 - 177,327,734 (-) NCBI Celera Cytogenetic Map 2 q32.1 NCBI HuRef 2 175,555,371 - 175,588,842 (-) NCBI HuRef CHM1_1 2 183,703,943 - 183,737,410 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 183,322,235 - 183,355,596 (-) NCBI T2T-CHM13v2.0
Frzb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 80,242,314 - 80,277,740 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 80,242,314 - 80,277,969 (-) Ensembl GRCm39 Ensembl GRCm38 2 80,411,970 - 80,447,396 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 80,411,970 - 80,447,625 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 80,252,127 - 80,287,553 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 80,212,809 - 80,248,235 (-) NCBI MGSCv36 mm8 Celera 2 82,075,833 - 82,112,383 (-) NCBI Celera Cytogenetic Map 2 C3 NCBI cM Map 2 48.13 NCBI
Frzb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 14,598,765 - 14,631,154 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 14,598,765 - 14,627,997 (+) NCBI ChiLan1.0 ChiLan1.0
FRZB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 85,492,596 - 85,525,895 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 85,507,574 - 85,540,875 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 70,106,378 - 70,139,333 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 187,915,579 - 187,948,855 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 187,915,579 - 187,948,855 (-) Ensembl panpan1.1 panPan2
FRZB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 25,884,557 - 25,907,436 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 25,884,557 - 25,907,369 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 25,782,614 - 25,812,978 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 26,038,918 - 26,069,318 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 26,039,164 - 26,076,017 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 26,165,036 - 26,195,383 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 26,095,997 - 26,126,346 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 26,237,636 - 26,268,037 (-) NCBI UU_Cfam_GSD_1.0
Frzb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 142,886,744 - 142,917,194 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 11,440,148 - 11,470,967 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 11,440,414 - 11,471,042 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FRZB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 88,332,860 - 88,377,247 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 88,332,856 - 88,377,275 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 97,838,143 - 97,881,633 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FRZB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 68,353,393 - 68,385,135 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 68,351,922 - 68,385,110 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 131,158,267 - 131,189,920 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Frzb
.
Predicted Target Of
Count of predictions: 195 Count of miRNA genes: 132 Interacting mature miRNAs: 161 Transcripts: ENSRNOT00000010247 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
RH132687
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 65,332,994 - 65,333,174 (+) MAPPER mRatBN7.2 Rnor_6.0 3 67,636,325 - 67,636,504 NCBI Rnor6.0 Rnor_5.0 3 74,196,884 - 74,197,063 UniSTS Rnor5.0 RGSC_v3.4 3 63,351,225 - 63,351,404 UniSTS RGSC3.4 Celera 3 64,780,818 - 64,780,997 UniSTS Cytogenetic Map 3 q24 UniSTS
RH134537
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 65,332,365 - 65,332,553 (+) MAPPER mRatBN7.2 Rnor_6.0 3 67,635,696 - 67,635,883 NCBI Rnor6.0 Rnor_5.0 3 74,196,255 - 74,196,442 UniSTS Rnor5.0 RGSC_v3.4 3 63,350,596 - 63,350,783 UniSTS RGSC3.4 Celera 3 64,780,189 - 64,780,376 UniSTS Cytogenetic Map 3 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010247 ⟹ ENSRNOP00000010247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 65,332,277 - 65,365,208 (-) Ensembl Rnor_6.0 Ensembl 3 67,635,607 - 67,668,772 (-) Ensembl
RefSeq Acc Id:
NM_001100527 ⟹ NP_001093997
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 85,739,162 - 85,772,096 (-) NCBI mRatBN7.2 3 65,332,274 - 65,365,208 (-) NCBI Rnor_6.0 3 67,635,604 - 67,668,772 (-) NCBI Rnor_5.0 3 74,196,163 - 74,229,331 (-) NCBI RGSC_v3.4 3 63,350,504 - 63,383,436 (-) RGD Celera 3 64,780,097 - 64,813,027 (-) RGD
Sequence:
GTCATTAACTCTCGCTGGATAGGGCCCTGCCATTGCTCTCAAGAGGCTGTGGTGTCTGCGACGTAGACATTTAAAGTGACTTTGCTCCAGCCTCCCAGCCCGACTTTCTGCAGGCGGAGGCTGATGTC
hide sequence
RefSeq Acc Id:
XM_063283281 ⟹ XP_063139351
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 85,739,162 - 85,772,168 (-) NCBI
RefSeq Acc Id:
NP_001093997 ⟸ NM_001100527
- Peptide Label:
precursor
- UniProtKB:
B2GUW1 (UniProtKB/TrEMBL), A6HMM9 (UniProtKB/TrEMBL), F7F8N4 (UniProtKB/TrEMBL)
- Sequence:
MVCRGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRH
hide sequence
Ensembl Acc Id:
ENSRNOP00000010247 ⟸ ENSRNOT00000010247
RefSeq Acc Id:
XP_063139351 ⟸ XM_063283281
- Peptide Label:
isoform X1
- UniProtKB:
A6HMM9 (UniProtKB/TrEMBL), B2GUW1 (UniProtKB/TrEMBL), F7F8N4 (UniProtKB/TrEMBL)
RGD ID: 13692171 Promoter ID: EPDNEW_R2695 Type: single initiation site Name: Frzb_1 Description: frizzled-related protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 67,667,987 - 67,668,047 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Frzb
frizzled-related protein
Frzb_predicted
frizzled-related protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Frzb_predicted
frizzled-related protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
