Advanced Search (OLGA)

Gene: Taar2 (trace amine associated receptor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Taar2

Name:

trace amine associated receptor 2

RGD ID:

1311240

Description:

Predicted to enable trace-amine receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be active in plasma membrane. Orthologous to human TAAR2 (trace amine associated receptor 2); INTERACTS WITH 17beta-estradiol; bisphenol A; trichloroethene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptor 58; G-protein coupled receptor 58; Gpr58; LOC294121; taR-2; trace amine receptor 2; trace amine-associated receptor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,319,526 - 23,323,495 (-)	NCBI		GRCr8
mRatBN7.2	1	21,500,290 - 21,504,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,500,067 - 21,504,299 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,277,273 - 21,281,245 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,277,318 - 27,281,290 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,476,907 - 21,480,882 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,578,025 - 22,581,994 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,578,025 - 22,581,994 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,052,952 - 24,056,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	22,027,912 - 22,031,881 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	22,030,856 - 22,034,826 (-)	NCBI
Celera	1	20,243,653 - 20,247,622 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar2	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Taar2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of TAAR2 mRNA	CTD	PMID:22206623
Taar2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of TAAR2 mRNA	CTD	PMID:26496021
Taar2	Rat	aflatoxin B1	increases methylation	ISO	TAAR2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of TAAR2 gene	CTD	PMID:27153756
Taar2	Rat	atrazine	increases expression	ISO	TAAR2 (Homo sapiens)	6480464	Atrazine results in increased expression of TAAR2 mRNA	CTD	PMID:22378314
Taar2	Rat	benzo[a]pyrene	affects methylation	ISO	TAAR2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of TAAR2 promoter	CTD	PMID:27901495
Taar2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of TAAR2 mRNA	CTD	PMID:26496021
Taar2	Rat	bisphenol A	increases methylation	ISO	TAAR2 (Homo sapiens)	6480464	bisphenol A results in increased methylation of TAAR2 gene	CTD	PMID:31601247
Taar2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TAAR2 mRNA	CTD	PMID:25181051
Taar2	Rat	CGP 52608	multiple interactions	ISO	TAAR2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to TAAR2 gene]	CTD	PMID:28238834
Taar2	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of TAAR2 gene	CTD	PMID:27618143

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IBA	FB:FBgn0029909 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR009132	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar2	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar2	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar2	Rat	plasma membrane	is_active_in	IBA	MGI:2148258 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Taar2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Taar2	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Taar2	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Taar2	Rat	trace-amine receptor activity	enables	IBA	MGI:2148258 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Taar2	Rat	trace-amine receptor activity	enables	IEA	InterPro:IPR009132	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15718104

Taar2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,319,526 - 23,323,495 (-)	NCBI		GRCr8
mRatBN7.2	1	21,500,290 - 21,504,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,500,067 - 21,504,299 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,277,273 - 21,281,245 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,277,318 - 27,281,290 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,476,907 - 21,480,882 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,578,025 - 22,581,994 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,578,025 - 22,581,994 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,052,952 - 24,056,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	22,027,912 - 22,031,881 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	22,030,856 - 22,034,826 (-)	NCBI
Celera	1	20,243,653 - 20,247,622 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

TAAR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	132,617,150 - 132,624,275 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	132,617,022 - 132,624,275 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	132,938,289 - 132,945,414 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	132,979,982 - 132,987,107 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	133,685,125 - 133,692,251 (-)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	130,513,205 - 130,520,335 (-)	NCBI		HuRef
CHM1_1	6	133,201,961 - 133,209,075 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	133,812,108 - 133,819,243 (-)	NCBI		T2T-CHM13v2.0

Taar2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	23,814,470 - 23,817,481 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	23,814,470 - 23,817,481 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	23,938,572 - 23,941,583 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	23,938,572 - 23,941,583 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	23,658,378 - 23,661,389 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	23,627,988 - 23,630,999 (+)	NCBI		MGSCv36	mm8
Celera	10	24,872,067 - 24,875,079 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	11.4	NCBI

TAAR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	152,599,973 - 152,600,967 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	150,507,054 - 150,508,048 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	130,393,716 - 130,394,710 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	134,501,267 - 134,502,261 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	134,501,267 - 134,508,387 (-)	Ensembl	panpan1.1		panPan2

LOC100686959
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	1	26,653,606 - 26,654,633 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	25,577,519 - 25,578,547 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	25,623,590 - 25,624,617 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	25,522,382 - 25,523,409 (-)	NCBI		UNSW_CanFamBas_1.0

TAAR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	31,073,654 - 31,074,574 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	31,067,713 - 31,074,574 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	34,587,889 - 34,594,760 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAAR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	40,901,944 - 40,929,519 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	40,921,295 - 40,928,506 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	13,110,187 - 13,117,320 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Taar2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624952	721,912 - 727,169 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Taar2
38 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	74
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000035424
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

Taar2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,500,472 - 21,501,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	22,578,208 - 22,578,992	NCBI	Rnor6.0
Rnor_5.0	1	24,053,135 - 24,053,919	UniSTS	Rnor5.0
RGSC_v3.4	1	22,028,095 - 22,028,879	UniSTS	RGSC3.4
Celera	1	20,243,836 - 20,244,620	UniSTS
Cytogenetic Map	1	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	reproductive system	respiratory system
2	5	6	4	2	4	8	2	19	2


RefSeq Transcripts	NM_001008512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY702316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035424 ⟹ ENSRNOP00000030671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,500,067 - 21,504,299 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,578,025 - 22,581,994 (-)	Ensembl

RefSeq Acc Id:

NM_001008512 ⟹ NP_001008512

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	23,319,526 - 23,323,495 (-)	NCBI
mRatBN7.2	1	21,500,290 - 21,504,259 (-)	NCBI
Rnor_6.0	1	22,578,025 - 22,581,994 (-)	NCBI
Rnor_5.0	1	24,052,952 - 24,056,922 (-)	NCBI
RGSC_v3.4	1	22,027,912 - 22,031,881 (-)	RGD
Celera	1	20,243,653 - 20,247,622 (-)	RGD

Sequence:

show sequence

ATGACATCTTTTGAAGCCCAACAGGAAACCTTCGATTGTTCAGAATATGGGAATGGATCTTGCCCAGAGAATGAAAGGTCTCTGGGGGTCCGAGCTGCAATGTACTCACTGATGGCAGGAGCCATCTT
CATCACGATCTTTGGCAACCTGGTCATGATCATTTCCATTTCCTACTTCAAGCAGCTTCACACACCGACCAACCTCCTCATTCTCTCCATGGCTGTCACCGACTTCCTGTTGGGATTCACCATCATGC
CATACAGTATGGTCCGGTCAGTGGAAAACTGCTGGTATTTTGGGCTTACCTTTTGCAAGATCCATTATAGCTTTGACCTGATGCTTAGCATAACGTCCATTTTCCACCTTTGCTCGGTGGCCATAGAT
AGATTTTACGCCATCTGTCACCCTTTGCATTATTGCACCAAAATGACTATTCCGGTCGTCAAGCGGCTGCTGCTCGTCTGCTGGTCAGTCCCCGGGGCGTTTGCCTTTGGGGTGGTCTTTTCAGAGGC
TTATGCTGATGGGATTGAAGGCTATGACATTTTGGTTGCATGTTCCAGTTCCTGCCCAGTCATGTTTAACAAGCTCTGGGGGACCACCTTATTTGTGGCGGGCTTTTTTACTCCGAGCTCCATGATGG
TGGGGATTTATGGCAAAATTTTCGCAGTATCCAAAAAACATGCTCGCGTAATTGACAACTTGCCAGAAAATCAAAATAATCAAATGAGGAAGGACAAAAAGGCAGCCAAAACCTTGGGGATAGTGATG
GGTGTTTTCTTACTGTGTTGGTTTCCATGTTTCTTCACGATCCTGCTAGATCCGTTTCTGAATTTCTCTACGCCTGCAATTCTGTTTGATGCCTTAACTTGGTTCGGCTATTTTAATTCCACATGTAA
TCCCTTAATTTATGGTTTCTTCTACCCCTGGTTTCGCAGAGCACTCAGGTACATTTTGCTGGGTAAAATTTTCAGCTCACATTTCCACAACACTAATTTGTTTACGCAAAAAGAAACAGAATAG

hide sequence


Protein RefSeqs	NP_001008512	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAV70128	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030671.4
GenBank Protein	Q5QD25	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008512 ⟸ NM_001008512

- UniProtKB:

Q5QD25 (UniProtKB/Swiss-Prot), A6JUN1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMAGAIFITIFGNLVMIISISYFKQLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIFHLCSVAID
RFYAICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNNQMRKDKKAAKTLGIVM
GVFLLCWFPCFFTILLDPFLNFSTPAILFDALTWFGYFNSTCNPLIYGFFYPWFRRALRYILLGKIFSSHFHNTNLFTQKETE

hide sequence

Ensembl Acc Id:

ENSRNOP00000030671 ⟸ ENSRNOT00000035424

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5QD25-F1-model_v2	AlphaFold	Q5QD25	1-339	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-62081	BioCyc
Ensembl Genes	ENSRNOG00000025951	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000035424.5	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	TAAR	UniProtKB/Swiss-Prot
	TAAR_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:294121	UniProtKB/Swiss-Prot
NCBI Gene	294121	ENTREZGENE
PANTHER	HISTAMINE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	TRACE AMINE-ASSOCIATED RECEPTOR 2	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Taar2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	TRACEAMINER	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000025951	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6JUN1	ENTREZGENE, UniProtKB/TrEMBL
	Q5QD25	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-02-12	Taar2	trace amine associated receptor 2	Taar2	trace amine-associated receptor 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Taar2	trace amine-associated receptor 2	Gpr58	G protein-coupled receptor 58	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gpr58	G protein-coupled receptor 58	Gpr58_predicted	G protein-coupled receptor 58 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gpr58_predicted	G protein-coupled receptor 58 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message