Advanced Search (OLGA)

Gene: Coq6 (coenzyme Q6 monooxygenase) Rattus norvegicus

Analyze

Symbol:

Coq6

Name:

coenzyme Q6 monooxygenase

RGD ID:

1311149

Description:

Predicted to enable 2-methoxy-6-polyprenolphenol 4-hydroxylase activity; 4-hydroxy-3-all-trans-polyprenylbenzoate oxygenase activity; and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen. Predicted to be involved in ubiquinone biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be part of ubiquinone biosynthesis complex. Predicted to be active in mitochondrion. Predicted to be extrinsic component of mitochondrial inner membrane. Human ortholog(s) of this gene implicated in primary coenzyme Q10 deficiency 6. Orthologous to human COQ6 (coenzyme Q6, monooxygenase); PARTICIPATES IN ubiquinone biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2-acetamidofluorene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

2-methoxy-6-polyprenolphenol 4-hydroxylase; coenzyme Q10 monooxygenase 6; coenzyme Q6 homolog; coenzyme Q6 homolog (S. cerevisiae); coenzyme Q6 homolog (yeast); coenzyme Q6 homolog, monooxygenase; coenzyme Q6 homolog, monooxygenase (S. cerevisiae); LOC299195; ubiquinone biosynthesis monooxygenase COQ6; ubiquinone biosynthesis monooxygenase COQ6, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COQ6 (coenzyme Q6, monooxygenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Coq6 (coenzyme Q6 monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Coq6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COQ6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COQ6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Coq6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COQ6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COQ6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Coq6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Coq6 (coenzyme Q6, monooxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	COQ6 (coenzyme Q6, monooxygenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Coq6 (coenzyme Q6 monooxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	coq6 (coenzyme Q6 monooxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7277	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	COQ6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	coq-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	coq6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	109,738,934 - 109,750,315 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	109,738,951 - 109,750,310 (+)	Ensembl				GRCr8
mRatBN7.2	6	104,007,814 - 104,019,888 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	104,007,872 - 104,024,657 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	104,169,638 - 104,180,978 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	104,468,722 - 104,480,062 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	103,838,304 - 103,849,644 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	108,076,393 - 108,087,782 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	108,076,306 - 108,087,696 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	117,458,615 - 117,469,989 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	108,425,610 - 108,436,950 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	101,836,154 - 101,847,494 (+)	NCBI		Celera
RGSC_v3.1	6	108,429,065 - 108,440,405 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

primary coenzyme Q10 deficiency 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-methoxyethanol (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

butan-1-ol (ISO)

cadmium atom (ISO)

carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO)

chloroquine (EXP)

cisplatin (ISO)

cobalt dichloride (EXP)

cocaine (EXP)

coumarin (EXP)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

diuron (EXP)

doxorubicin (ISO)

Evodiamine (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

hydrogen peroxide (ISO)

leflunomide (EXP)

Mesaconitine (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

sodium arsenate (ISO)

triphenyl phosphate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ubiquinone biosynthetic process (IBA,IEA,ISO,ISS)

Cellular Component

cell projection (IEA)

extrinsic component of mitochondrial inner membrane (IEA,ISO)

Golgi apparatus (IEA)

mitochondrial inner membrane (IEA,ISO)

mitochondrion (IBA,IEA,ISO)

Molecular Function

2-methoxy-6-polyprenolphenol 4-hydroxylase activity (IEA,ISO,ISS)

4-hydroxy-3-all-trans-polyprenylbenzoate oxygenase activity (IEA,ISO,ISS)

FAD binding (IEA)

flavin adenine dinucleotide binding (IEA)

monooxygenase activity (IEA)

oxidoreductase activity (IBA,IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen (IEA,ISO)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquinone biosynthetic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015

Genomics

Comparative Map Data

Coq6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	109,738,934 - 109,750,315 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	109,738,951 - 109,750,310 (+)	Ensembl				GRCr8
mRatBN7.2	6	104,007,814 - 104,019,888 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	104,007,872 - 104,024,657 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	104,169,638 - 104,180,978 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	104,468,722 - 104,480,062 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	103,838,304 - 103,849,644 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	108,076,393 - 108,087,782 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	108,076,306 - 108,087,696 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	117,458,615 - 117,469,989 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	108,425,610 - 108,436,950 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	101,836,154 - 101,847,494 (+)	NCBI		Celera
RGSC_v3.1	6	108,429,065 - 108,440,405 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

COQ6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	73,949,918 - 73,963,670 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	73,949,926 - 73,963,670 (+)	Ensembl			hg38	GRCh38
GRCh37	14	74,416,621 - 74,430,373 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	73,486,396 - 73,499,568 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	73,486,395 - 73,499,564	NCBI
Celera	14	54,453,591 - 54,466,758 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	54,583,510 - 54,596,662 (+)	NCBI		HuRef
CHM1_1	14	74,356,228 - 74,369,390 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	68,157,571 - 68,171,324 (+)	NCBI		T2T-CHM13v2.0

Coq6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	84,408,530 - 84,420,570 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	84,408,431 - 84,420,570 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	84,361,756 - 84,373,796 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	84,361,657 - 84,373,796 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	85,702,918 - 85,714,746 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	85,251,795 - 85,263,538 (+)	NCBI		MGSCv36	mm8
Celera	12	85,816,955 - 85,828,822 (+)	NCBI		Celera
Cytogenetic Map	12	D1	NCBI
cM Map	12	39.18	NCBI

Coq6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955523	1,444,901 - 1,458,718 (-)	Ensembl
ChiLan1.0	NW_004955523	1,444,675 - 1,458,769 (-)	NCBI	ChiLan1.0	ChiLan1.0

COQ6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	75,040,265 - 75,052,991 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	74,256,773 - 74,269,498 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	54,509,514 - 54,522,310 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	73,363,928 - 73,376,566 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	73,363,711 - 73,376,545 (+)	Ensembl			panPan2	panpan1.1

COQ6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	47,177,376 - 47,190,143 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	47,177,358 - 47,190,141 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	46,861,658 - 46,874,458 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	47,406,384 - 47,419,201 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	47,406,402 - 47,463,317 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	47,074,036 - 47,086,836 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	47,092,068 - 47,104,856 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	47,482,437 - 47,495,221 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Coq6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	28,828,109 - 28,851,060 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	3,217,288 - 3,236,438 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	3,217,868 - 3,240,375 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COQ6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	97,258,653 - 97,271,093 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	97,258,617 - 97,270,927 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	103,012,788 - 103,024,492 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COQ6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	51,164,328 - 51,178,522 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	51,164,378 - 51,177,620 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	39,377,942 - 39,391,147 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Coq6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	27,610,248 - 27,626,298 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	27,610,144 - 27,625,670 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Coq6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	98,465,465 - 98,476,309 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Coq6
86 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	45
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000014913
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat

Markers in Region

RH91551

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,017,609 - 104,017,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	108,086,192 - 108,086,561	NCBI	Rnor6.0
Rnor_5.0	6	117,459,836 - 117,460,205	UniSTS	Rnor5.0
RGSC_v3.4	6	108,435,360 - 108,435,729	UniSTS	RGSC3.4
Celera	6	101,845,904 - 101,846,273	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH133793

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	109,750,255 - 109,750,449 (+)	Marker Load Pipeline
mRatBN7.2	6	104,019,140 - 104,019,334 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	108,087,723 - 108,087,916	NCBI	Rnor6.0
Rnor_5.0	6	117,458,481 - 117,458,674	UniSTS	Rnor5.0
RGSC_v3.4	6	108,436,891 - 108,437,084	UniSTS	RGSC3.4
Celera	6	101,847,435 - 101,847,628	UniSTS
RH 3.4 Map	6	742.4	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH134512

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	109,749,119 - 109,750,106 (+)	Marker Load Pipeline
mRatBN7.2	6	104,018,004 - 104,018,991 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	108,086,587 - 108,087,573	NCBI	Rnor6.0
Rnor_5.0	6	117,458,824 - 117,459,810	UniSTS	Rnor5.0
RGSC_v3.4	6	108,435,755 - 108,436,741	UniSTS	RGSC3.4
Celera	6	101,846,299 - 101,847,285	UniSTS
RH 3.4 Map	6	742.4	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH134627

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,019,009 - 104,019,164 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	108,087,592 - 108,087,746	NCBI	Rnor6.0
Rnor_5.0	6	117,458,651 - 117,458,805	UniSTS	Rnor5.0
RGSC_v3.4	6	108,436,760 - 108,436,914	UniSTS	RGSC3.4
Celera	6	101,847,304 - 101,847,458	UniSTS
RH 3.4 Map	6	742.4	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH140906

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,018,933 - 104,019,143 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	108,087,516 - 108,087,725	NCBI	Rnor6.0
Rnor_5.0	6	117,458,672 - 117,458,881	UniSTS	Rnor5.0
RGSC_v3.4	6	108,436,684 - 108,436,893	UniSTS	RGSC3.4
Celera	6	101,847,228 - 101,847,437	UniSTS
RH 3.4 Map	6	742.4	UniSTS
Cytogenetic Map	6	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014913 ⟹ ENSRNOP00000014914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	109,738,951 - 109,750,310 (+)	Ensembl
mRatBN7.2 Ensembl	6	104,007,872 - 104,024,657 (+)	Ensembl
Rnor_6.0 Ensembl	6	108,076,306 - 108,087,696 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107126 ⟹ ENSRNOP00000094755

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	109,738,951 - 109,750,310 (+)	Ensembl
mRatBN7.2 Ensembl	6	104,007,872 - 104,024,657 (+)	Ensembl

RefSeq Acc Id:

NM_001011983 ⟹ NP_001011983

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	109,738,975 - 109,750,315 (+)	NCBI
mRatBN7.2	6	104,007,860 - 104,019,200 (+)	NCBI
Rnor_6.0	6	108,076,442 - 108,087,782 (+)	NCBI
Rnor_5.0	6	117,458,615 - 117,469,989 (-)	NCBI
RGSC_v3.4	6	108,425,610 - 108,436,950 (+)	RGD
Celera	6	101,836,154 - 101,847,494 (+)	RGD

Sequence:

show sequence

GTCGCGGACGTAGGCTGGAGTCTTTATGGCGGCCCGCATTGGCCCCATGGCAGGTTTGCTCTGT
GTTCGCTGGTGGAGTACCGCGCAACTTGCAGCCAGAGGAGGCCCACTAGTTGCCTGTCGGCGAT
GGACGAGCTCCTCGACAGACTCCGTGTACGATGTGGTGGTGTCAGGAGGAGGCATGGTGGGCTC
TGCCATGGCTTGTGCCTTGGGACATGATATTCACTTTCATGACAAGAAAATCCTATTGCTGGAA
GCGGGTCCGAAGAAAACCCTGGAGAAACTGTCAGAAACTTACAGCAACAGAGTCAGCTCCATAT
CCCTTGGCTCCACAACCCTTCTCAGCAGTTTTGGTGCATGGGACCACATCTGCAATATGCGTTG
CAAAGCCTTCCGGCGGATGCAGGTTTGGGACTCCTGCTCAGAGGCCTTGATAATGTTCGACAAG
GATAACTTGGATGACATGGGCTATATAGTGGAAAATGACGTCATCATGCACGCCATCACCAAGC
AGCTGGAGGCGGTGGCAGATCGAGTGAAGGTTCTCTACGAGAGCAAAGCTGTTGGCTATGCCTG
GCCTGGTCCATTTTCCTTGGCAGACTCCAGCCCTTGGGTCCATATTACCCTAGGTGATGGCAGC
ACCCTCCAGACCAAGCTGTTGATTGGTGCTGATGGCCACAACTCAGGAGTGAGGCAAGCTGCTG
GGATCCAGAATGTTGGCTGGAACTACGACCAGTCTGCTGTGGTGGCCACTCTCCACTTATCAGA
GGCCACAGAAAACAATGTAGCCTGGCAGAGATTTCTTCCCTCTGGGCCTATTGCTCTGCTCCCG
CTCTCAGATACCCTGAGTTCCTTGGTGTGGTCCACGTCACATGCCCATGCAGCCGAGCTGGTCA
GCATGCATGAGGAAGAGTTCGTGGATGCCATCAACTCGGCCTTTTGGAGTGATGTTCACCACAC
AGACTTCGTCGACTCAGCTAGTGCCATGGTGCACCATGCTGTCGCCCTTCTGAAGCCCACTAAG
GTCTCCGCCCGCCAGCTGCCCCCAAGCGTAGCCAAGGTGGATGCCAAGAGCAGAGCCCTCTTTC
CTCTGGGGCTGGGACATGCTGCTGAGTACGTCCGGCCTCGGGTGGCCCTCATCGGTGATGCAGC
CCACAGAGTCCATCCACTTGCAGGACAAGGTGTCAACATGGGCTTCGGGGATATTTCCAGCTTG
ATTCATTATCTCAGTACAGCAGCCTTCAATGGCAAGGACTTAGGCTCCATGAGCCACCTCACAG
GCTATGAAACAGACCGACAGCGTCATAATACTGCTCTTCTGGCTGCTACTGACCTGCTGAAAAG
GCTCTACTCTACCAGTACCACTCCGCTAGTGTTGCTCAGGACCTGGGGCCTGCAGGCCACTAAT
GCAGTGTCTCCTCTCAAAGAACAGATTATGGCCTTTGCGAGTAGATGAGGGCCCCTCTTCTGGG
GACCATGGTGATGACAAAGAACACCTAGCCCTGGGACATCACAGGCCTTCCCAGTATGGACTAA
TAAACTTACACTGGAACTTGTGTCTCTTCCTCTTCTGATTAATGCATCTGTGGAGCCAAAACAG
TGACAGCTAAGGAAGAACCCAAAGGAAAACTATTTAATCAAAGGTTTTTATTACTACACAGAGG
AGTCACCGAGATGCTGTCCCTCATTTCACTCGGTAACAATCCATTCTAAATAAAGTACTTTAAT
GCTGGTCATAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039112027 ⟹ XP_038967955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	109,739,047 - 109,750,129 (+)	NCBI
mRatBN7.2	6	104,007,851 - 104,019,018 (+)	NCBI

RefSeq Acc Id:

XM_039112028 ⟹ XP_038967956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	109,738,934 - 109,747,732 (+)	NCBI
mRatBN7.2	6	104,007,814 - 104,016,619 (+)	NCBI

RefSeq Acc Id:

XM_063261736 ⟹ XP_063117806

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	109,738,935 - 109,749,235 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001011983	(Get FASTA)	NCBI Sequence Viewer
	XP_038967955	(Get FASTA)	NCBI Sequence Viewer
	XP_038967956	(Get FASTA)	NCBI Sequence Viewer
	XP_063117806	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79342	(Get FASTA)	NCBI Sequence Viewer
	EDL81500	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014914
	ENSRNOP00000014914.5
	ENSRNOP00000094755
GenBank Protein	Q68FU7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001011983 ⟸ NM_001011983
- Peptide Label:	precursor
- UniProtKB:	Q68FU7 (UniProtKB/Swiss-Prot), A6JDV5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAARIGPMAGLLCVRWWSTAQLAARGGPLVACRRWTSSSTDSVYDVVVSGGGMVGSAMACALGH DIHFHDKKILLLEAGPKKTLEKLSETYSNRVSSISLGSTTLLSSFGAWDHICNMRCKAFRRMQV WDSCSEALIMFDKDNLDDMGYIVENDVIMHAITKQLEAVADRVKVLYESKAVGYAWPGPFSLAD SSPWVHITLGDGSTLQTKLLIGADGHNSGVRQAAGIQNVGWNYDQSAVVATLHLSEATENNVAW QRFLPSGPIALLPLSDTLSSLVWSTSHAHAAELVSMHEEEFVDAINSAFWSDVHHTDFVDSASA MVHHAVALLKPTKVSARQLPPSVAKVDAKSRALFPLGLGHAAEYVRPRVALIGDAAHRVHPLAG QGVNMGFGDISSLIHYLSTAAFNGKDLGSMSHLTGYETDRQRHNTALLAATDLLKRLYSTSTTP LVLLRTWGLQATNAVSPLKEQIMAFASR hide sequence

Ensembl Acc Id:

ENSRNOP00000014914 ⟸ ENSRNOT00000014913

RefSeq Acc Id:	XP_038967956 ⟸ XM_039112028
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038967955 ⟸ XM_039112027
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AN07 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094755 ⟸ ENSRNOT00000107126

RefSeq Acc Id:	XP_063117806 ⟸ XM_063261736
- Peptide Label:	isoform X1

Protein Domains

FAD-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FU7-F1-model_v2	AlphaFold	Q68FU7	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694724

Promoter ID:

EPDNEW_R5249

Type:

initiation region

Name:

Coq6_1

Description:

coenzyme Q6 monooxygenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	108,076,458 - 108,076,518	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311149	AgrOrtholog
BioCyc Gene	G2FUF-36822	BioCyc
BioCyc Pathway	PWY-5872 [ubiquinol-10 biosynthesis (late decarboxylation)]	BioCyc
BioCyc Pathway Image	PWY-5872	BioCyc
Ensembl Genes	ENSRNOG00000011164	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000014913	ENTREZGENE
	ENSRNOT00000014913.7	UniProtKB/Swiss-Prot
	ENSRNOT00000107126	ENTREZGENE
Gene3D-CATH	3.50.50.60	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7106851	IMAGE-MGC_LOAD
InterPro	FAD-bd	UniProtKB/Swiss-Prot
	FAD/NAD-bd_sf	UniProtKB/Swiss-Prot
	Ubi_Hdrlase_CS	UniProtKB/Swiss-Prot
	UbiH/COQ6	UniProtKB/Swiss-Prot
	UbiH/COQ6_monooxygenase	UniProtKB/Swiss-Prot
	UbQ_mOase_COQ6	UniProtKB/Swiss-Prot
KEGG Report	rno:299195	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94790	IMAGE-MGC_LOAD
NCBI Gene	299195	ENTREZGENE
PANTHER	UBIQUINONE BIOSYNTHESIS MONOOXYGENASE COQ6, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	UBIQUINONE BIOSYNTHESIS MONOOXYGENASE COQ6, MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	FAD_binding_3	UniProtKB/Swiss-Prot
PhenoGen	Coq6	PhenoGen
PRINTS	RNGMNOXGNASE	UniProtKB/Swiss-Prot
PROSITE	UBIH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011164	RatGTEx
Superfamily-SCOP	SSF51905	UniProtKB/Swiss-Prot
UniProt	A0A8I6AN07	ENTREZGENE, UniProtKB/TrEMBL
	A6JDV5	ENTREZGENE, UniProtKB/TrEMBL
	COQ6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-16	Coq6	coenzyme Q6 monooxygenase	Coq6	coenzyme Q6 homolog, monooxygenase (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-01-07	Coq6	coenzyme Q6 homolog, monooxygenase (S. cerevisiae)	Coq6	coenzyme Q6 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-20	Coq6	coenzyme Q6 homolog (S. cerevisiae)	Coq6	coenzyme Q6 homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Coq6	coenzyme Q6 homolog (yeast)	Coq6_predicted	coenzyme Q6 homolog (yeast) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Coq6_predicted	coenzyme Q6 homolog (yeast) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways