Advanced Search (OLGA)

Gene: Fezf2 (Fez family zinc finger 2) Rattus norvegicus

Analyze

Symbol:

Fezf2

Name:

Fez family zinc finger 2

RGD ID:

1311068

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in several processes, including cell dedifferentiation; positive regulation of DNA-templated transcription; and regulation of neurogenesis. Predicted to act upstream of or within several processes, including negative regulation of transcription by RNA polymerase II; nervous system development; and regulation of neuron differentiation. Predicted to be located in nucleus. Orthologous to human FEZF2 (FEZ family zinc finger 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

fez family zinc finger protein 2; LOC305719; Zfp312; zinc finger protein 312

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FEZF2 (FEZ family zinc finger 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fezf2 (Fez family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fezf2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FEZF2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FEZF2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fezf2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FEZF2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FEZF2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fezf2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fezf2 (FEZ family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GLI4 (GLI family zinc finger 4)	HGNC	Panther
Homo sapiens (human):	ZNF648 (zinc finger protein 648)	HGNC	Panther
Alliance orthologs ³
Mus musculus (house mouse):	Fezf2 (Fez family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FEZF2 (FEZ family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fezf2 (FEZ family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fezf2 (FEZ family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fezf-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fezf-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	erm	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	erm	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fezf2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	15,199,045 - 15,207,982 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	15,204,193 - 15,207,982 (+)	Ensembl				GRCr8
mRatBN7.2	15	12,768,614 - 12,777,554 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	12,773,762 - 12,777,554 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	14,902,423 - 14,906,214 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	15,860,874 - 15,864,667 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	14,115,673 - 14,119,460 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,825,333 - 12,831,496 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,827,707 - 12,831,496 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	16,852,526 - 16,858,715 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	14,350,796 - 14,354,585 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	12,771,624 - 12,775,413 (+)	NCBI		Celera
RGSC_v3.1	15	14,350,780 - 14,354,571 (+)	NCBI
Cytogenetic Map	15	p15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

choline (ISO)

clofibrate (ISO)

Cuprizon (EXP)

diiodine (ISO)

dimethylarsinic acid (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethylparaben (ISO)

fenthion (ISO)

fenvalerate (EXP)

folic acid (ISO)

fulvestrant (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

nitrogen dioxide (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

tetracycline (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axonal fasciculation (ISO)

cell dedifferentiation (IEA,ISO)

cell differentiation (IEA)

cerebral cortex GABAergic interneuron migration (ISO)

cerebral cortex neuron differentiation (ISO)

commitment of neuronal cell to specific neuron type in forebrain (ISO)

dendrite development (ISO)

dentate gyrus development (ISO)

DNA-templated transcription (IEA)

forebrain anterior/posterior pattern specification (IEA,ISO)

forebrain development (ISO)

interneuron migration (IEA)

locomotory behavior (ISO)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of neuron differentiation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

nervous system development (IEA)

neuron fate determination (ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of neuron differentiation (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA)

regulation of axon guidance (ISO)

regulation of neurogenesis (IEA,ISO)

telencephalon development (IEA,ISO)

Cellular Component

nucleus (IEA)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

metal ion binding (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15188439	PMID:16284245	PMID:16314561	PMID:16971467	PMID:20152183	PMID:20431123	PMID:21338885	PMID:23144223	PMID:24997765	PMID:28245922

Genomics

Comparative Map Data

Fezf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	15,199,045 - 15,207,982 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	15,204,193 - 15,207,982 (+)	Ensembl				GRCr8
mRatBN7.2	15	12,768,614 - 12,777,554 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	12,773,762 - 12,777,554 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	14,902,423 - 14,906,214 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	15,860,874 - 15,864,667 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	14,115,673 - 14,119,460 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,825,333 - 12,831,496 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,827,707 - 12,831,496 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	16,852,526 - 16,858,715 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	14,350,796 - 14,354,585 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	12,771,624 - 12,775,413 (+)	NCBI		Celera
RGSC_v3.1	15	14,350,780 - 14,354,571 (+)	NCBI
Cytogenetic Map	15	p15	NCBI

FEZF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	62,369,681 - 62,373,550 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	62,369,681 - 62,374,473 (-)	Ensembl			hg38	GRCh38
GRCh37	3	62,355,356 - 62,359,225 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	62,330,387 - 62,334,230 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	62,330,398 - 62,334,061	NCBI
Celera	3	62,372,439 - 62,376,282 (-)	NCBI		Celera
Cytogenetic Map	3	p14.2	NCBI
HuRef	3	62,453,442 - 62,457,287 (-)	NCBI		HuRef
CHM1_1	3	62,306,475 - 62,310,318 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	62,413,195 - 62,417,065 (-)	NCBI		T2T-CHM13v2.0

Fezf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	10,121,561 - 10,130,771 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	10,121,574 - 10,127,669 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	12,338,992 - 12,346,803 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	12,342,094 - 12,348,189 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	13,174,406 - 13,178,379 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	11,135,369 - 11,139,095 (-)	NCBI		MGSCv36	mm8
Celera	14	7,971,161 - 7,975,134 (-)	NCBI		Celera
Cytogenetic Map	14	A1	NCBI
cM Map	14	6.36	NCBI

Fezf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955517	3,439,999 - 3,443,846 (+)	Ensembl
ChiLan1.0	NW_004955517	3,439,999 - 3,443,477 (+)	NCBI	ChiLan1.0	ChiLan1.0

FEZF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	62,204,917 - 62,317,594 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	62,318,265 - 62,323,032 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	62,292,878 - 62,296,987 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	63,679,898 - 63,683,700 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	63,680,307 - 63,683,052 (-)	Ensembl			panPan2	panpan1.1

FEZF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	28,704,287 - 28,708,620 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	28,703,623 - 28,708,282 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	28,630,343 - 28,636,829 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	28,936,971 - 28,943,463 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	28,940,148 - 28,943,133 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	28,422,707 - 28,429,181 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	28,780,654 - 28,787,141 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	28,880,642 - 28,887,134 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fezf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	165,652,364 - 165,661,504 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936637	4,047,119 - 4,052,741 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936637	4,045,224 - 4,051,058 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FEZF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	43,953,910 - 43,957,473 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	43,953,914 - 43,958,419 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	47,998,138 - 48,002,064 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FEZF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	23,442,699 - 23,453,026 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	23,443,114 - 23,445,908 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	143,417,725 - 143,422,588 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fezf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624888	3,462,233 - 3,468,293 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624888	3,462,132 - 3,467,701 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fezf2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	82,411,060 - 82,414,884 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fezf2
30 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	45
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000012452
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat

Markers in Region

BE107866

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	12,776,996 - 12,777,173 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	12,830,939 - 12,831,115	NCBI	Rnor6.0
Rnor_5.0	15	16,858,158 - 16,858,334	UniSTS	Rnor5.0
RGSC_v3.4	15	14,354,028 - 14,354,204	UniSTS	RGSC3.4
Celera	15	12,774,856 - 12,775,032	UniSTS
RH 3.4 Map	15	107.9	UniSTS
Cytogenetic Map	15	p16	UniSTS

MARC_15281-15282:1013612096:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	12,774,766 - 12,775,226 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	12,828,712 - 12,829,171	NCBI	Rnor6.0
Rnor_5.0	15	16,855,931 - 16,856,390	UniSTS	Rnor5.0
RGSC_v3.4	15	14,351,801 - 14,352,260	UniSTS	RGSC3.4
Celera	15	12,772,629 - 12,773,088	UniSTS
Cytogenetic Map	15	p16	UniSTS

GDB:1318551

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	12,772,862 - 12,772,950 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	12,826,808 - 12,826,895	NCBI	Rnor6.0
Rnor_5.0	15	16,854,027 - 16,854,114	UniSTS	Rnor5.0
RGSC_v3.4	15	14,349,897 - 14,349,984	UniSTS	RGSC3.4
Celera	15	12,770,725 - 12,770,812	UniSTS
Cytogenetic Map	15	p16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
2	5	113	29	25	12	14	12	4	51	26	3	103	11	39	13	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012452 ⟹ ENSRNOP00000012452

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	15,204,193 - 15,207,982 (+)	Ensembl
mRatBN7.2 Ensembl	15	12,773,762 - 12,777,554 (+)	Ensembl
Rnor_6.0 Ensembl	15	12,827,707 - 12,831,496 (+)	Ensembl

RefSeq Acc Id:

NM_001107251 ⟹ NP_001100721

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	15,204,193 - 15,207,982 (+)	NCBI
mRatBN7.2	15	12,773,762 - 12,777,554 (+)	NCBI
Rnor_6.0	15	12,827,707 - 12,831,496 (+)	NCBI
Rnor_5.0	15	16,852,526 - 16,858,715 (+)	NCBI
RGSC_v3.4	15	14,350,796 - 14,354,585 (+)	RGD
Celera	15	12,771,624 - 12,775,413 (+)	RGD

Sequence:

show sequence

TAGTTGCCTCCTTTAAAGTTTGAGGGGCGGTGGCGGCGGCCGGCAGGCGCGGGGGAACGCAGGG
TCCTCAACGGGAGTCGCGCCGCCGCCCATGTCATTCCACTTCAAGTGACTTCATGTGATGTCAG
CTGAATGTAAAAGACAGTGATCTCACGCGGAGGGGAGGATGTTTGCCATCAAAATGTGACAGAA
GAGACACGCTGCATGGCTCGGAACGCATCTCCTTGGCGGTGGGGGAAAAAGACTTAGAGGAGAG
AGGCTGTGCCCTGGCCCAGCCTGGCTCAGCTTGGCGCGCCATGGCCAGCTCAGCTTCCCTGGAG
ACCATGGTGCCCCCGGCCTGCCCGCGCGCTGGAGCGTCACCGGCCACTTCGAAAACACTAGCTT
TCTCCATCGAGCGCATCATGGCCAAGACGTCCGAGCCCCGAGCGCCTTTTGAGCCCCGGCCTGC
TGCGCTAGAGGCAGACAGCAGCCAGAGCAAGAAACTGCTCAACCTCTGCTCGCCGCTGCCCTGT
ATGATCCCCCTCCAGCCTCTAGGCTACGAGGTGCCGTCCAAGACACTGCTCAGTTACTCGGAGT
TCTGGAAAAGCAGCCTCCGGGCGGGCGGCGGTGGAGGAGGAGGCAGCGGCGGGGGGGGCCCAGT
GTGCGGCGCCAGTGGCTTGTGCAAAACCAACTGTGGCGTGTGCTGCAAGGCCGAACTGGGCCTT
GCGCCTTCTGCGCTGCCCGCCGGCAGGGTCATCAAGCCGCAGGTCATCAACCAGGCTGTGGGGC
TGCCGGCCAGCGGCTCTCTCTACTACTTCAACTACCTGGACTCCACCACTTACCCACCATCGGA
GCTCCTCGGAGGCCACCTTTTCCCATCTGGCCTCCTCAACGCACAGGCCCCCACTTCCCTGGCT
GCTCACCCCAAGCTTTTTCTGCTGGAGAATGCCAAACTGGCCAGCCTGACTGCGGACAAGTTCC
CCCACCCAGCTTCCTATCCCCATAAGGAGCGCTTGCATGCGCCGCTGGAGCAGGTGCTGAAGGA
GAACTCGGCCTTGACCGCTGAACGAGGGGGAGTCAAGAGCCACAGCAAACTACCGGGGGGCTCT
ACTGACAGCAAACCCAAAAACTTCACCTGCGAAGTGTGCGGCAAGGTGTTCAATGCTCACTATA
ACCTCACCCGCCACATGCCTGTCCACACCGGAGCTAGACCGTTTGTGTGCAAAGTCTGTGGCAA
AGGCTTCCGCCAGGCCAGCACTCTCTGCAGACACAAAATTATCCATACCCAGGAAAAACCACAT
AAGTGTAACCAGTGCGGCAAAGCCTTCAATCGCAGCTCCACGCTCAATACGCACATCCGCATCC
ACGCGGGCTACAAGCCCTTCGTCTGCGAGTTTTGCGGCAAGGGCTTTCACCAAAAAGGGAACTA
CAAGAACCACAAGCTCACACACAGCGGCGAGAAGCAGTACAAATGCACTATCTGTAACAAGGCC
TTCCACCAGGTGTACAATCTGACCTTCCACATGCACACCCACAACGACAAGAAGCCCTTCACAT
GCGCCACTTGCGGCAAAGGTTTTTGCAGAAACTTTGACTTAAAGAAACATGTGCGCAAACTTCA
TGACAGCGTGGGTCCCACCGCCACCCCCTCAGCAAAGGGCCTAGCCAGGACAGTTCAGAGCTGA
GAGCTACTGCCTTGTCCTTTCTTCCTGCCCTGTACCAACCCGAGCAGATCCCACGTATAAACTT
ATTTCTAAAATTAAAAGGAAAAAAACTATAGCAGAGAGGCTAAAATCTATTTATCGAAACCAGC
ATATTTTTGGGAAATGTAAACGTGTCCTCGATGACCGGCAGCAAACGCGTGGCTCCCACCTTTG
TACATTCAGGAAACGTATTTAAATCCAGTGCGCTGAAACATGTTTAATTCCAGGCCTCGGCTTC
TCCTCAGGCAGCCGGCTTTTAATCCCAGCCTGTCACCATGAGCGCCCAGAAGAACGTGATGCCC
CCAGCCGTCTTCACACAACCTTGTAATCTCTCCTGTACAAGCGAACACGGAATATTACACATAT
ATGACTCAATAAACAGAACCACTA

hide sequence

RefSeq Acc Id:

XM_039093242 ⟹ XP_038949170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	15,201,857 - 15,207,976 (+)	NCBI
mRatBN7.2	15	12,771,349 - 12,777,548 (+)	NCBI

RefSeq Acc Id:

XM_039093243 ⟹ XP_038949171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	15,199,045 - 15,207,976 (+)	NCBI
mRatBN7.2	15	12,768,614 - 12,777,548 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100721	(Get FASTA)	NCBI Sequence Viewer
	XP_038949170	(Get FASTA)	NCBI Sequence Viewer
	XP_038949171	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68214	(Get FASTA)	NCBI Sequence Viewer
	EDL94136	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012452
	ENSRNOP00000012452.4

RefSeq Acc Id:

NP_001100721 ⟸ NM_001107251

- UniProtKB:

B4F7C0 (UniProtKB/TrEMBL), A6K089 (UniProtKB/TrEMBL), F7ERI8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPAALEADSSQSKKLL
NLCSPLPCMIPLQPLGYEVPSKTLLSYSEFWKSSLRAGGGGGGGSGGGGPVCGASGLCKTNCGV
CCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTTYPPSELLGGHLFPSGLLN
AQAPTSLAAHPKLFLLENAKLASLTADKFPHPASYPHKERLHAPLEQVLKENSALTAERGGVKS
HSKLPGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKI
IHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQY
KCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPTATPSAKG
LARTVQS

hide sequence

Ensembl Acc Id:

ENSRNOP00000012452 ⟸ ENSRNOT00000012452

RefSeq Acc Id:	XP_038949171 ⟸ XM_039093243
- Peptide Label:	isoform X1
- UniProtKB:	B4F7C0 (UniProtKB/TrEMBL), A6K089 (UniProtKB/TrEMBL), F7ERI8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038949170 ⟸ XM_039093242
- Peptide Label:	isoform X1
- UniProtKB:	B4F7C0 (UniProtKB/TrEMBL), A6K089 (UniProtKB/TrEMBL), F7ERI8 (UniProtKB/TrEMBL)

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B4F7C0-F1-model_v2	AlphaFold	B4F7C0	1-455	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311068	AgrOrtholog
BioCyc Gene	G2FUF-14354	BioCyc
Ensembl Genes	ENSRNOG00000009206	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012452	ENTREZGENE
	ENSRNOT00000012452.7	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:305719	UniProtKB/TrEMBL
NCBI Gene	305719	ENTREZGENE
PANTHER	ZINC FINGER PROTEIN	UniProtKB/TrEMBL
	ZINC FINGER PROTEIN 771	UniProtKB/TrEMBL
Pfam	zf-C2H2	UniProtKB/TrEMBL
	zf-C2H2_6	UniProtKB/TrEMBL
PhenoGen	Fezf2	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009206	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A6K089	ENTREZGENE, UniProtKB/TrEMBL
	B4F7C0	ENTREZGENE
	F7ERI8	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B4F7C0	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Fezf2	Fez family zinc finger 2	Zfp312_predicted	zinc finger protein 312 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Zfp312_predicted	zinc finger protein 312 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar