Advanced Search (OLGA)

Gene: Ffar3 (free fatty acid receptor 3) Rattus norvegicus

Analyze

Symbol:

Ffar3

Name:

free fatty acid receptor 3

RGD ID:

1311035

Description:

Enables G protein-coupled receptor activity. Involved in G protein-coupled receptor signaling pathway and cellular response to fatty acid. Predicted to be active in plasma membrane. Orthologous to several human genes including FFAR3 (free fatty acid receptor 3); INTERACTS WITH 1,2-dimethylhydrazine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptor 41; G-protein coupled receptor 41; Gpr41; LOC365228

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FFAR3 (free fatty acid receptor 3)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103234509 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GPR42 (G protein-coupled receptor 42)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	FFAR2 (free fatty acid receptor 2)	HGNC	OrthoDB
Homo sapiens (human):	CASKIN1 (CASK interacting protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FFAR3 (free fatty acid receptor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPR42 (G protein-coupled receptor 42)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPR42 (G protein-coupled receptor 42)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ffar3 (free fatty acid receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-90p23.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:ch73-90p23.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	si:dkey-211g8.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-211g8.6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ffar3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC108644815	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	95,232,336 - 95,234,354 (-)	Ensembl				GRCr8
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,520,010 - 91,521,350 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,986,179 - 99,987,519 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,278,309 - 93,279,649 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,302,035 - 89,304,064 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,473,836 - 80,475,176 (-)	NCBI		Celera
RGSC_v3.1	1	85,961,180 - 85,991,480 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

essential hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-D (ISO)

2-palmitoylglycerol (ISO)

3-hydroxybutyric acid (ISO)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

D-glucose (ISO)

fructose (ISO)

gardiquimod (ISO)

glucose (ISO)

hydralazine (ISO)

linoleic acid (ISO)

propamocarb (ISO)

protein kinase inhibitor (ISO)

resveratrol (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO,ISS)

cellular response to fatty acid (IBA,IDA,ISO)

G protein-coupled receptor signaling pathway (IBA,IDA,IEA,ISO)

glucose homeostasis (ISO)

immune system process (IEA)

inflammatory response (IEA)

mucosal immune response (ISO,ISS)

negative regulation of blood pressure (ISO,ISS)

positive regulation of action potential (ISO)

positive regulation of acute inflammatory response to non-antigenic stimulus (ISO,ISS)

positive regulation of chemokine production (ISO,ISS)

positive regulation of cytokine production involved in immune response (ISO,ISS)

regulation of heart rate by chemical signal (ISO)

regulation of hormone biosynthetic process (ISO,ISS)

regulation of insulin receptor signaling pathway (ISO,ISS)

regulation of norepinephrine secretion (ISS)

regulation of peptide hormone secretion (ISO,ISS)

signal transduction (IEA)

Cellular Component

membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS)

Molecular Function

G protein-coupled receptor activity (IBA,IDA,IEA,ISO)

lipid binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The Orphan G protein-coupled receptors GPR41 and GPR43 are activated by propionate and other short chain carboxylic acids.	Brown AJ, etal., J Biol Chem. 2003 Mar 28;278(13):11312-9. Epub 2002 Dec 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14722361	PMID:18801738	PMID:19047060	PMID:21518883	PMID:22190648	PMID:22673524	PMID:23401498	PMID:23665276	PMID:24748202	PMID:26854275	PMID:28714277
PMID:34216575

Genomics

Comparative Map Data

Ffar3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	95,232,336 - 95,234,354 (-)	Ensembl				GRCr8
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,520,010 - 91,521,350 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,986,179 - 99,987,519 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,278,309 - 93,279,649 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,302,035 - 89,304,064 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,473,836 - 80,475,176 (-)	NCBI		Celera
RGSC_v3.1	1	85,961,180 - 85,991,480 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

FFAR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,358,151 - 35,360,489 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,358,348 - 35,360,489 (+)	Ensembl			hg38	GRCh38
GRCh37	19	35,849,362 - 35,851,391 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,541,342 - 40,543,231 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	40,541,341 - 40,543,227	NCBI
Celera	19	32,562,940 - 32,564,843 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,357,984 - 32,370,911 (+)	NCBI		HuRef
CHM1_1	19	35,851,096 - 35,852,999 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	37,902,884 - 37,905,223 (+)	NCBI		T2T-CHM13v2.0

Ffar3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,553,755 - 30,555,603 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,553,755 - 30,555,603 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	30,854,330 - 30,856,178 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,854,330 - 30,856,178 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	31,639,349 - 31,641,197 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,563,090 - 30,564,938 (-)	NCBI		MGSCv36	mm8
Celera	7	25,437,774 - 25,439,622 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	19.25	NCBI

Ffar3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	4,627,686 - 4,634,499 (+)	Ensembl
ChiLan1.0	NW_004955468	4,627,686 - 4,634,499 (+)	NCBI	ChiLan1.0	ChiLan1.0

FFAR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,371,323 - 41,373,439 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,354,671 - 43,356,787 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,305,112 - 32,307,223 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,041,808 - 41,055,938 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,054,341 - 41,055,381 (+)	Ensembl			panPan2	panpan1.1

FFAR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	117,251,604 - 117,257,048 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,654,563 - 116,656,672 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,851,342 - 117,853,431 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UNSW_CanFamBas_1.0	1	117,040,133 - 117,042,241 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	118,095,603 - 118,097,714 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ffar3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	10,693,229 - 10,696,348 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	950,149 - 951,123 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	949,575 - 951,442 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FFAR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	44,844,149 - 44,845,172 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,332,798 - 40,339,457 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103234509
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,296,020 - 30,306,671 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	8,085,695 - 8,087,971 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ffar3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	8,200,101 - 8,202,145 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ffar3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	165,161,909 - 165,163,861 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ffar3
3 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	197
Count of miRNA genes:	133
Interacting mature miRNAs:	150
Transcripts:	ENSRNOT00000056714
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	31	44	11	15	8	1	8	1	63	34	41	5	41	7	6	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056714 ⟹ ENSRNOP00000053557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	95,232,336 - 95,234,354 (-)	Ensembl
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl

RefSeq Acc Id:

NM_001108912 ⟹ NP_001102382

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI
Rnor_6.0	1	89,302,507 - 89,303,847 (-)	NCBI
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	RGD
Celera	1	80,473,836 - 80,475,176 (-)	RGD

Sequence:

show sequence

GTAGGAGCTAGCTGGGTGCTGGGCGGCAGCGTGCCAGCTCTCCAACACTCTGCATCTGTGACCA
TGGACACAAGCTTCTTTCCCGGCAACCACTGGCTTTTCTTTTCAGTGGATCTGTTGGTGTTCCT
CGTGGGACTACCCCTCAACGTGATGGCCCTGGTGGTCTTCGTGAACAAGCTGCGTCGCCGCCCG
GTGGCCGTGGACTTACTTTTGCTTAACCTGACCATTTCGGACCTGCTTCTGCTCCTCTTCCTGC
CATTCCGTATAGTGGAGGCGGCCTGTGGCATGAAATGGATTCTGCCCTTCATCTTCTGCCCCCT
TTCTGGCTTCCTTTTCTTCACCACCATCTACCTCACCTCCCTCTTCCTGATGACGGTGAGCATA
GAACGTTTTCTGAGCGTAGCCTACCCACTGTGGTACAAAACCCGGCCCCGGCTGGCCCAGGCTG
GTCTGGTCAGTGGCATCTGTTGGTTCTTGGCATCAGCTCACTGTAGTGTGATTTATGTCACTGA
ATACTGGGGAAATGCAACCTACAGCCAGGGGACCAACGGAACCTGCTACCTGGAATTCCGGGAG
GACCAGCTGGCCATCCTCCTCCCCGTGCGACTGGAAATGGCTGTGGTCCTTTTCATGGTGCCCC
TGTGTATTACCAGTTACTGCTACAGTCGCCTGGTGTGGATTCTGAGCCAGGGAGCCAGCCGGCG
CAGGCGCAAGAGAGTGATGGGGCTTCTTGTAGCCACGTTGCTCATCTTCTTTGTCTGCTTCGGC
CCCTACAATATGTCCCACGTGGTGGGCTACGTGCGCGGTGAGAGTCCGACCTGGCGGAGCTACG
TGCTTCTCCTCAGCACCCTCAACTCTTGTATTGACCCTCTGGTTTTCTACTTTTCATCCTCCAA
GTTCCAAGCCGACTTTCATCAGCTCCTGTCTAGGCTGATCAGAGCTTGTGTGCCTTGGACTCAG
GAAGTCAGCTTGGAACTGAAGGTAAAGAACGGAGAAGAGCCATCCAAGGAATGTCCGAGCTAGA
GAAAAGAGTGGACCGGAGGAGGGGTGTGGAAAACACTGGCTCAGCGCTTTGGCCAGCAGAGAGC
TCTCCGGGGTCAGGAAGGAGTGGGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102382	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66522	(Get FASTA)	NCBI Sequence Viewer
	B2GV46	(Get FASTA)	NCBI Sequence Viewer
	EDM07705	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053557.2

RefSeq Acc Id:

NP_001102382 ⟸ NM_001108912

- UniProtKB:

B2GV46 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDTSFFPGNHWLFFSVDLLVFLVGLPLNVMALVVFVNKLRRRPVAVDLLLLNLTISDLLLLLFL
PFRIVEAACGMKWILPFIFCPLSGFLFFTTIYLTSLFLMTVSIERFLSVAYPLWYKTRPRLAQA
GLVSGICWFLASAHCSVIYVTEYWGNATYSQGTNGTCYLEFREDQLAILLPVRLEMAVVLFMVP
LCITSYCYSRLVWILSQGASRRRRKRVMGLLVATLLIFFVCFGPYNMSHVVGYVRGESPTWRSY
VLLLSTLNSCIDPLVFYFSSSKFQADFHQLLSRLIRACVPWTQEVSLELKVKNGEEPSKECPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000053557 ⟸ ENSRNOT00000056714

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV46-F1-model_v2	AlphaFold	B2GV46	1-319	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311035	AgrOrtholog
BioCyc Gene	G2FUF-60068	BioCyc
Ensembl Genes	ENSRNOG00000037467	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000056714.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134236	IMAGE-MGC_LOAD
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	GPR40-rel_orph	UniProtKB/Swiss-Prot
KEGG Report	rno:365228	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188106	IMAGE-MGC_LOAD
NCBI Gene	365228	ENTREZGENE
PANTHER	FREE FATTY ACID RECEPTOR 2-RELATED	UniProtKB/Swiss-Prot
	FREE FATTY ACID RECEPTOR 3-RELATED	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Ffar3	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	GPR40FAMILY	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000037467	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	B2GV46	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Ffar3	free fatty acid receptor 3	Gpr41_predicted	G protein-coupled receptor 41 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Gpr41_predicted	G protein-coupled receptor 41 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD