Symbol:
Cst9l
Name:
cystatin 9-like
RGD ID:
1311032
Description:
Predicted to enable cysteine-type endopeptidase inhibitor activity. Predicted to be involved in antimicrobial humoral response. Predicted to be active in extracellular space. Orthologous to several human genes including CST9L (cystatin 9 like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; aflatoxin B1; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Cst9; cystatin 9; LOC362231
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 156,741,232 - 156,744,045 (+) NCBI GRCr8 mRatBN7.2 3 136,288,093 - 136,290,906 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 136,288,093 - 136,290,906 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 140,240,024 - 140,242,835 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 148,824,174 - 148,826,985 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 146,513,723 - 146,516,536 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 143,172,691 - 143,175,504 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 143,172,686 - 143,175,500 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 149,581,044 - 149,583,857 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 137,601,785 - 137,604,598 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 137,507,294 - 137,510,171 (+) NCBI Celera 3 135,129,456 - 135,132,269 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Cst9l (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 156,741,232 - 156,744,045 (+) NCBI GRCr8 mRatBN7.2 3 136,288,093 - 136,290,906 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 136,288,093 - 136,290,906 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 140,240,024 - 140,242,835 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 148,824,174 - 148,826,985 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 146,513,723 - 146,516,536 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 143,172,691 - 143,175,504 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 143,172,686 - 143,175,500 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 149,581,044 - 149,583,857 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 137,601,785 - 137,604,598 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 137,507,294 - 137,510,171 (+) NCBI Celera 3 135,129,456 - 135,132,269 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
CST9L (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 23,564,732 - 23,568,484 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 23,564,732 - 23,568,484 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 23,545,369 - 23,549,121 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 23,493,369 - 23,497,329 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 20 23,618,635 - 23,622,652 (-) NCBI Celera Cytogenetic Map 20 p11.21 NCBI HuRef 20 23,506,670 - 23,510,688 (-) NCBI HuRef CHM1_1 20 23,545,153 - 23,549,170 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 23,624,266 - 23,628,019 (-) NCBI T2T-CHM13v2.0
Cst9 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 148,677,067 - 148,680,657 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 148,677,067 - 148,680,658 (+) Ensembl GRCm39 Ensembl GRCm38 2 148,835,147 - 148,838,737 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 148,835,147 - 148,838,738 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 148,660,883 - 148,664,473 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 148,526,588 - 148,530,178 (+) NCBI MGSCv36 mm8 Celera 2 150,098,314 - 150,104,986 (+) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 73.58 NCBI
LOC485559 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 1,913 - 5,329 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 33,977 - 39,594 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 245,047 - 250,664 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 23 103,818 - 109,435 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 186,015 - 191,632 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 175,050 - 180,667 (-) NCBI UU_Cfam_GSD_1.0
LOC100516302 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 30,451,597 - 30,454,777 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 30,451,710 - 30,454,724 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 34,540,856 - 34,543,898 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CST9L (Chlorocebus sabaeus - green monkey)
.
Predicted Target Of
Count of predictions: 222 Count of miRNA genes: 166 Interacting mature miRNAs: 180 Transcripts: ENSRNOT00000006869 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000006869 ⟹ ENSRNOP00000006869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 136,288,093 - 136,290,906 (+) Ensembl Rnor_6.0 Ensembl 3 143,172,686 - 143,175,500 (+) Ensembl
RefSeq Acc Id:
NM_001108597 ⟹ NP_001102067
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 156,741,232 - 156,744,045 (+) NCBI mRatBN7.2 3 136,288,093 - 136,290,906 (+) NCBI Rnor_6.0 3 143,172,691 - 143,175,504 (+) NCBI Rnor_5.0 3 149,581,044 - 149,583,857 (+) NCBI RGSC_v3.4 3 137,601,785 - 137,604,598 (+) RGD Celera 3 135,129,456 - 135,132,269 (+) RGD
Sequence:
GATAGACTCCCTGGGCCTGACGGGCTAAGGCAGACAAAGCAGTGGCGGTGCAGTTCTGGCACCATGTCCTGTCCACTGGGAAAGAAAGCCCTGCCTCAGGCCATGCTGCTACTTCTGCTTAGCTTTCA GGTTCTCATCACTCCTGTCACAAAGGCCAATGAAGAAACAGACAAATCTGTTAATTTCATTCCCACAGTGGAATTTGCCGTGAACACGTTCAACCAGAAAAGTCAGGATGAATATGCCTATAGAATGG AACATATCATGAGTTCCTGGAGGGAGGAGGTAGATCATCCAATTGTGTTTTCCATGAGGCTTCGGCTGCGTAGAACCATATGCAAGAAATTTGAGGAGAGCCTTGACATTTGCCCCTTTCAGGAGAGT CATGATCGGAATAATACCTTCACCTGCCTATTCACTGTTGGTACCTTGCCCTGGATAACAGAATTCCAGCTCTTCAAGAATGTGTGTTCATAGTTCCTCTGACTGGAGTCATCCACGGTCTGGCCATG TACTTCTCTGCATCCATGAAGTGGTTAATCTTGGGAGAACCTCTGTGCTCATGTTCCTTGTTTTGCAACATTGTATGGTATGAAGACTGGGTATGTGAATAATAACTAGGGAAATGCATATCACTGTT GTTTCATCATTTATAATAGTTCATTAAATATTGCGTTTCTGAA
hide sequence
RefSeq Acc Id:
NP_001102067 ⟸ NM_001108597
- Peptide Label:
precursor
- UniProtKB:
D3ZMS9 (UniProtKB/TrEMBL), A6K7D7 (UniProtKB/TrEMBL)
- Sequence:
MSCPLGKKALPQAMLLLLLSFQVLITPVTKANEETDKSVNFIPTVEFAVNTFNQKSQDEYAYRMEHIMSSWREEVDHPIVFSMRLRLRRTICKKFEESLDICPFQESHDRNNTFTCLFTVGTLPWITE FQLFKNVCS
hide sequence
Ensembl Acc Id:
ENSRNOP00000006869 ⟸ ENSRNOT00000006869
RGD ID: 13692504
Promoter ID: EPDNEW_R3028
Type: initiation region
Name: Cst9l_1
Description: cystatin 9-like
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 143,172,722 - 143,172,782 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-26
Cst9l
cystatin 9-like
Cst9
cystatin 9
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-04-30
Cst9
cystatin 9
Cst9_predicted
cystatin 9 (predicted)
'predicted' is removed
2292626
APPROVED
2005-01-12
Cst9_predicted
cystatin 9 (predicted)
Symbol and Name status set to approved
70820
APPROVED