Symbol:
Loxl3
Name:
lysyl oxidase-like 3
RGD ID:
1311011
Description:
Predicted to enable fibronectin binding activity and protein-lysine 6-oxidase activity. Predicted to be involved in several processes, including collagen fibril organization; fibronectin fibril organization; and negative regulation of T-helper 17 cell lineage commitment. Predicted to be located in cytoplasm; extracellular region; and nucleus. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Human ortholog(s) of this gene implicated in myopia. Orthologous to human LOXL3 (lysyl oxidase like 3); INTERACTS WITH acetamide; acrylamide; atrazine.
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
LOC312478; lysyl oxidase homolog 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LOXL3 (lysyl oxidase like 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Loxl3 (lysyl oxidase-like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Loxl3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOXL3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOXL3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Loxl3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOXL3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOXL3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Loxl3 (lysyl oxidase like 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZFP90 (ZFP90 zinc finger protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
LOXL3 (lysyl oxidase like 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Loxl3 (lysyl oxidase-like 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
loxl3b (lysyl oxidase-like 3b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
loxl3a (lysyl oxidase-like 3a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Loxl2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,098,358 - 117,114,673 (+) NCBI GRCr8 mRatBN7.2 4 115,540,640 - 115,556,958 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 115,540,685 - 115,557,466 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,017,222 - 121,033,539 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,792,423 - 116,808,736 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,406,990 - 115,423,299 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,866,782 - 113,883,713 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,866,804 - 113,883,477 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 178,552,500 - 178,568,813 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,245,933 - 117,262,248 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 117,491,707 - 117,506,378 (+) NCBI Celera 4 104,535,320 - 104,551,634 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Loxl3 Rat 17alpha-ethynylestradiol multiple interactions ISO Loxl3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LOXL3 mRNA CTD PMID:17942748 Loxl3 Rat 17beta-estradiol increases expression ISO LOXL3 (Homo sapiens) 6480464 Estradiol results in increased expression of LOXL3 mRNA CTD PMID:31614463 Loxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Loxl3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LOXL3 mRNA CTD PMID:17942748 Loxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Loxl3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LOXL3 mRNA CTD PMID:27562557 Loxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Loxl3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LOXL3 mRNA CTD PMID:21570461 Loxl3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LOXL3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LOXL3 mRNA CTD PMID:20106945 and PMID:21632981 Loxl3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Loxl3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of LOXL3 mRNA CTD PMID:20188158 Loxl3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Loxl3 (Mus musculus) 6480464 bisphenol S results in decreased methylation of LOXL3 exon CTD PMID:33297965 Loxl3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of LOXL3 mRNA CTD PMID:31881176 Loxl3 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of LOXL3 mRNA CTD PMID:28959563 Loxl3 Rat all-trans-retinoic acid increases expression ISO LOXL3 (Homo sapiens) 6480464 Tretinoin results in increased expression of LOXL3 mRNA CTD PMID:33167477 Loxl3 Rat arsenite(3-) decreases expression ISO Loxl3 (Mus musculus) 6480464 arsenite results in decreased expression of LOXL3 mRNA CTD PMID:18929588 Loxl3 Rat arsenite(3-) affects expression ISO LOXL3 (Homo sapiens) 6480464 arsenite affects the expression of LOXL3 mRNA CTD PMID:22959463 Loxl3 Rat arsenite(3-) multiple interactions ISO Loxl3 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of LOXL3 mRNA] CTD PMID:18929588 Loxl3 Rat atrazine increases expression ISO LOXL3 (Homo sapiens) 6480464 Atrazine results in increased expression of LOXL3 mRNA CTD PMID:22378314 Loxl3 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of LOXL3 mRNA CTD PMID:36841081 Loxl3 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LOXL3 gene CTD PMID:33854195 Loxl3 Rat benzo[a]pyrene increases expression ISO Loxl3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LOXL3 mRNA CTD PMID:32417428 Loxl3 Rat benzo[a]pyrene decreases methylation ISO LOXL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of LOXL3 5' UTR CTD PMID:27901495 Loxl3 Rat benzo[a]pyrene increases methylation ISO LOXL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LOXL3 promoter CTD PMID:27901495 Loxl3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LOXL3 mRNA CTD PMID:25181051 more ... Loxl3 Rat bisphenol A decreases expression ISO Loxl3 (Mus musculus) 6480464 bisphenol A results in decreased expression of LOXL3 mRNA CTD PMID:29161229 Loxl3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LOXL3 gene CTD PMID:28505145 Loxl3 Rat bisphenol F decreases expression ISO Loxl3 (Mus musculus) 6480464 bisphenol F results in decreased expression of LOXL3 mRNA CTD PMID:38685157 Loxl3 Rat cadmium dichloride decreases expression ISO LOXL3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of LOXL3 mRNA CTD PMID:38568856 Loxl3 Rat carbamazepine affects expression ISO LOXL3 (Homo sapiens) 6480464 Carbamazepine affects the expression of LOXL3 mRNA CTD PMID:25979313 Loxl3 Rat carbon nanotube decreases expression ISO Loxl3 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of LOXL3 mRNA CTD PMID:25926378 Loxl3 Rat CGP 52608 multiple interactions ISO LOXL3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LOXL3 gene] CTD PMID:28238834 Loxl3 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LOXL3 gene CTD PMID:33854195 Loxl3 Rat chromium(6+) increases expression ISO LOXL3 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of LOXL3 protein CTD PMID:28596144 Loxl3 Rat cisplatin multiple interactions ISO Loxl3 (Mus musculus) 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of LOXL3 mRNA CTD PMID:23625948 Loxl3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LOXL3 mRNA CTD PMID:26577399 Loxl3 Rat deoxynivalenol decreases expression ISO LOXL3 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of LOXL3 mRNA CTD PMID:31863870 Loxl3 Rat dexamethasone decreases expression ISO LOXL3 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of LOXL3 mRNA CTD PMID:25047013 Loxl3 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of LOXL3 mRNA CTD PMID:21658437 Loxl3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of LOXL3 mRNA CTD PMID:25152437 Loxl3 Rat epoxiconazole decreases expression ISO Loxl3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of LOXL3 mRNA CTD PMID:35436446 Loxl3 Rat ethanol increases expression ISO Loxl3 (Mus musculus) 6480464 Ethanol results in increased expression of LOXL3 mRNA CTD PMID:30319688 Loxl3 Rat furan increases methylation EXP 6480464 furan results in increased methylation of LOXL3 gene CTD PMID:22079235 Loxl3 Rat furan increases expression EXP 6480464 furan results in increased expression of LOXL3 mRNA CTD PMID:27387713 Loxl3 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LOXL3 gene CTD PMID:33854195 Loxl3 Rat hypochlorous acid decreases expression ISO Loxl3 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of LOXL3 mRNA CTD PMID:19376150 Loxl3 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LOXL3 gene CTD PMID:33854195 Loxl3 Rat irinotecan decreases expression ISO LOXL3 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of LOXL3 mRNA CTD PMID:18927307 Loxl3 Rat lead diacetate decreases expression ISO Loxl3 (Mus musculus) 6480464 lead acetate results in decreased expression of LOXL3 mRNA CTD PMID:22609695 Loxl3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO LOXL3 (Homo sapiens) 6480464 [Endocrine Disruptors results in increased abundance of mono-(2-ethylhexyl)phthalate] which affects the methylation of LOXL3 gene CTD PMID:32916427 Loxl3 Rat Monobutylphthalate multiple interactions ISO LOXL3 (Homo sapiens) 6480464 [Phthalic Acids results in increased abundance of monobutyl phthalate] which results in decreased methylation of LOXL3 gene CTD PMID:37741207 Loxl3 Rat niclosamide increases expression ISO LOXL3 (Homo sapiens) 6480464 Niclosamide results in increased expression of LOXL3 mRNA CTD PMID:36318118 Loxl3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LOXL3 mRNA CTD PMID:25729387 Loxl3 Rat perfluorohexanesulfonic acid increases expression ISO Loxl3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of LOXL3 mRNA CTD PMID:37995155 Loxl3 Rat silicon dioxide increases expression ISO LOXL3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of LOXL3 mRNA CTD PMID:25895662 Loxl3 Rat silver atom increases expression ISO Loxl3 (Mus musculus) 6480464 Silver results in increased expression of LOXL3 mRNA CTD PMID:27131904 Loxl3 Rat silver(0) increases expression ISO Loxl3 (Mus musculus) 6480464 Silver results in increased expression of LOXL3 mRNA CTD PMID:27131904 Loxl3 Rat sodium arsenite decreases expression ISO LOXL3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LOXL3 mRNA CTD PMID:38568856 Loxl3 Rat sunitinib decreases expression ISO LOXL3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of LOXL3 mRNA CTD PMID:31533062 Loxl3 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased methylation of LOXL3 gene CTD PMID:33854195 Loxl3 Rat thiram decreases expression ISO LOXL3 (Homo sapiens) 6480464 Thiram results in decreased expression of LOXL3 mRNA CTD PMID:38568856 Loxl3 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of LOXL3 mRNA CTD PMID:25729387 Loxl3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LOXL3 mRNA CTD PMID:25729387 Loxl3 Rat tris(2-butoxyethyl) phosphate affects expression ISO LOXL3 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of LOXL3 mRNA CTD PMID:29024780 Loxl3 Rat tunicamycin decreases expression ISO LOXL3 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of LOXL3 mRNA CTD PMID:22378314 Loxl3 Rat valproic acid affects expression ISO Loxl3 (Mus musculus) 6480464 Valproic Acid affects the expression of LOXL3 mRNA CTD PMID:17292431 Loxl3 Rat valproic acid increases expression ISO LOXL3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LOXL3 mRNA CTD PMID:23179753 Loxl3 Rat valproic acid affects expression ISO LOXL3 (Homo sapiens) 6480464 Valproic Acid affects the expression of LOXL3 mRNA CTD PMID:25979313 Loxl3 Rat valproic acid decreases expression ISO LOXL3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of LOXL3 mRNA CTD PMID:28001369
Loxl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,098,358 - 117,114,673 (+) NCBI GRCr8 mRatBN7.2 4 115,540,640 - 115,556,958 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 115,540,685 - 115,557,466 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,017,222 - 121,033,539 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,792,423 - 116,808,736 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,406,990 - 115,423,299 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,866,782 - 113,883,713 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,866,804 - 113,883,477 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 178,552,500 - 178,568,813 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,245,933 - 117,262,248 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 117,491,707 - 117,506,378 (+) NCBI Celera 4 104,535,320 - 104,551,634 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
LOXL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 74,532,258 - 74,555,702 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 74,532,258 - 74,555,690 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 74,759,385 - 74,781,069 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 74,613,454 - 74,634,570 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 74,671,600 - 74,692,717 NCBI Celera 2 74,591,054 - 74,612,170 (-) NCBI Celera Cytogenetic Map 2 p13.1 NCBI HuRef 2 74,496,207 - 74,517,323 (-) NCBI HuRef CHM1_1 2 74,689,342 - 74,710,457 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 74,540,824 - 74,564,305 (-) NCBI T2T-CHM13v2.0
Loxl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,011,186 - 83,029,547 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,011,154 - 83,029,543 (+) Ensembl GRCm39 Ensembl GRCm38 6 83,034,205 - 83,052,566 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,034,173 - 83,052,562 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 82,984,218 - 83,002,558 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 82,999,882 - 83,018,222 (+) NCBI MGSCv36 mm8 Celera 6 85,015,734 - 85,035,153 (+) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Loxl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 11,236,836 - 11,259,570 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 11,236,415 - 11,255,801 (+) NCBI ChiLan1.0 ChiLan1.0
LOXL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 51,833,505 - 51,856,127 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 51,836,098 - 51,858,879 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 74,598,870 - 74,622,502 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 76,105,957 - 76,128,495 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 76,105,957 - 76,128,495 (-) Ensembl panpan1.1 panPan2
LOXL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 48,590,996 - 48,610,264 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 48,591,768 - 48,610,392 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 48,232,758 - 48,252,169 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 49,450,304 - 49,469,724 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 49,450,333 - 49,469,843 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 48,467,472 - 48,486,874 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 48,534,207 - 48,553,616 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 49,091,871 - 49,111,294 (+) NCBI UU_Cfam_GSD_1.0
Loxl3
LOXL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 68,498,189 - 68,517,445 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 68,498,114 - 68,516,829 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 71,670,347 - 71,688,501 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOXL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 32,722,588 - 32,745,480 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 32,725,112 - 32,745,004 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 79,425,804 - 79,448,819 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Loxl3
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 36 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000010293 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
RH124140
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 44,766,673 - 44,767,926 (+) MAPPER mRatBN7.2 mRatBN7.2 4 115,555,823 - 115,556,054 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,882,579 - 113,882,809 NCBI Rnor6.0 Rnor_6.0 15 51,361,065 - 51,362,317 NCBI Rnor6.0 Rnor_5.0 15 55,088,807 - 55,090,059 UniSTS Rnor5.0 Rnor_5.0 4 178,567,679 - 178,567,909 UniSTS Rnor5.0 RGSC_v3.4 4 117,261,114 - 117,261,344 UniSTS RGSC3.4 RGSC_v3.4 15 50,064,728 - 50,065,980 UniSTS RGSC3.4 Celera 15 44,449,013 - 44,450,265 UniSTS Celera 4 104,550,500 - 104,550,730 UniSTS Cytogenetic Map 4 q34 UniSTS Cytogenetic Map 15 p11 UniSTS
RH128117
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 117,114,839 - 117,115,159 (+) Marker Load Pipeline mRatBN7.2 4 115,557,124 - 115,557,444 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,883,880 - 113,884,199 NCBI Rnor6.0 Rnor_5.0 4 178,568,980 - 178,569,299 UniSTS Rnor5.0 RGSC_v3.4 4 117,262,415 - 117,262,734 UniSTS RGSC3.4 Celera 4 104,551,801 - 104,552,120 UniSTS Cytogenetic Map 4 q34 UniSTS
Loxl3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 115,555,575 - 115,556,931 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,882,331 - 113,883,686 NCBI Rnor6.0 Rnor_5.0 4 178,567,431 - 178,568,786 UniSTS Rnor5.0 RGSC_v3.4 4 117,260,866 - 117,262,221 UniSTS RGSC3.4 Celera 4 104,550,252 - 104,551,607 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000081196 ⟹ ENSRNOP00000074073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 115,540,685 - 115,557,466 (+) Ensembl Rnor_6.0 Ensembl 4 113,866,804 - 113,883,477 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105834 ⟹ ENSRNOP00000083226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 115,540,685 - 115,557,466 (+) Ensembl
RefSeq Acc Id:
NM_001107866 ⟹ NP_001101336
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,098,358 - 117,114,673 (+) NCBI mRatBN7.2 4 115,540,640 - 115,556,958 (+) NCBI Rnor_6.0 4 113,867,398 - 113,883,713 (+) NCBI Rnor_5.0 4 178,552,500 - 178,568,813 (+) NCBI RGSC_v3.4 4 117,245,933 - 117,262,248 (+) RGD Celera 4 104,535,320 - 104,551,634 (+) RGD
Sequence:
GAGGAAGGGGGGGTCCAGTCTCCCCTGGCCGAACACTTTTTTTCTGAGAAGTCCTGAAAGTAATCTCCAGGACCAGGACTCTGCTTCCAGCCTCTGGAGTTCTGCCTAGTCGAAGTGCCCCCCCTCCT
hide sequence
RefSeq Acc Id:
XM_039107586 ⟹ XP_038963514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,105,472 - 117,114,673 (+) NCBI mRatBN7.2 4 115,551,103 - 115,556,958 (+) NCBI
RefSeq Acc Id:
NP_001101336 ⟸ NM_001107866
- Peptide Label:
precursor
- UniProtKB:
D3ZP82 (UniProtKB/TrEMBL), A6IAI6 (UniProtKB/TrEMBL)
- Sequence:
MRAVNVCYCCPWRLLLLHFLCSSSMGSPSPSTDPEKKVGSQGLRFRLAGFPRKPYEGRVEIQRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCKGTEGSVTECASR
hide sequence
Ensembl Acc Id:
ENSRNOP00000074073 ⟸ ENSRNOT00000081196
RefSeq Acc Id:
XP_038963514 ⟸ XM_039107586
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000083226 ⟸ ENSRNOT00000105834
RGD ID: 13693162 Promoter ID: EPDNEW_R3687 Type: initiation region Name: Loxl3_1 Description: lysyl oxidase-like 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 113,867,443 - 113,867,503 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Loxl3
lysyl oxidase-like 3
Loxl3_predicted
lysyl oxidase-like 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Loxl3_predicted
lysyl oxidase-like 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
