Advanced Search (OLGA)

Gene: Noc4l (nucleolar complex associated 4 homolog) Rattus norvegicus

Analyze

Symbol:

Noc4l

Name:

nucleolar complex associated 4 homolog

RGD ID:

1310661

Description:

Predicted to be involved in ribosome biogenesis. Predicted to be located in nuclear membrane and nucleoplasm. Predicted to be part of Noc4p-Nop14p complex and small-subunit processome. Predicted to be active in nucleolus. Orthologous to human NOC4L (nucleolar complex associated 4 homolog); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC360828; NOC4 protein homolog; NOC4-like protein; nucleolar complex associated 4 homolog (S. cerevisiae); nucleolar complex protein 4 homolog; nucleolar complex-associated protein 4-like protein; RGD1310661; similar to hypothetical protein MGC28606

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NOC4L (nucleolar complex associated 4 homolog)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Noc4l (NOC4 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Noc4l (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NOC4L (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NOC4L (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Noc4l (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NOC4L (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NOC4L (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Noc4l (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Noc4l (nucleolar complex associated 4 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Noc4l (NOC4 like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NOC4L (nucleolar complex associated 4 homolog)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	noc4l (nucleolar complex associated 4 homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2875	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NOC4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T20B12.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T20B12.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	noc4l	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	51,675,852 - 51,680,392 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	51,675,838 - 51,680,390 (+)	Ensembl				GRCr8
mRatBN7.2	12	46,016,077 - 46,020,615 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,016,069 - 46,020,614 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	47,191,651 - 47,196,189 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	47,796,996 - 47,801,545 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	46,857,522 - 46,862,071 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,072,190 - 52,076,728 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,072,188 - 52,076,739 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	53,810,417 - 53,814,958 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	46,160,644 - 46,165,182 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	47,574,806 - 47,579,344 (+)	NCBI		Celera
RGSC_v3.1	12	46,024,770 - 46,029,309 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

allethrin (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cyclosporin A (ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

diazinon (ISO)

dioxygen (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

mono(2-ethylhexyl) phthalate (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

pyrethrins (EXP)

rotenone (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ribosome biogenesis (IEA)

Cellular Component

Noc4p-Nop14p complex (IBA)

nuclear membrane (IEA)

nucleolus (IBA,IEA,ISO)

nucleus (IEA)

small-subunit processome (IBA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:22658674

Genomics

Comparative Map Data

Noc4l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	51,675,852 - 51,680,392 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	51,675,838 - 51,680,390 (+)	Ensembl				GRCr8
mRatBN7.2	12	46,016,077 - 46,020,615 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,016,069 - 46,020,614 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	47,191,651 - 47,196,189 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	47,796,996 - 47,801,545 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	46,857,522 - 46,862,071 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,072,190 - 52,076,728 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,072,188 - 52,076,739 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	53,810,417 - 53,814,958 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	46,160,644 - 46,165,182 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	47,574,806 - 47,579,344 (+)	NCBI		Celera
RGSC_v3.1	12	46,024,770 - 46,029,309 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

NOC4L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	132,144,457 - 132,152,468 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	132,144,425 - 132,152,473 (+)	Ensembl			hg38	GRCh38
GRCh37	12	132,629,002 - 132,637,013 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	131,194,946 - 131,202,939 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	132,247,260 - 132,255,092 (+)	NCBI		Celera
Cytogenetic Map	12	q24.33	NCBI
HuRef	12	129,514,331 - 129,521,262 (+)	NCBI		HuRef
CHM1_1	12	132,448,857 - 132,456,570 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	132,194,000 - 132,202,764 (+)	NCBI		T2T-CHM13v2.0

Noc4l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	110,796,285 - 110,801,248 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	110,796,284 - 110,801,283 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	110,648,419 - 110,653,382 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	110,648,418 - 110,653,417 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	111,077,438 - 111,082,401 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	110,888,721 - 110,893,684 (-)	NCBI		MGSCv36	mm8
Celera	5	107,780,403 - 107,785,389 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	53.69	NCBI

Noc4l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	626,347 - 631,998 (-)	Ensembl
ChiLan1.0	NW_004955482	626,347 - 631,998 (-)	NCBI	ChiLan1.0	ChiLan1.0

NOC4L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	140,240,734 - 140,247,087 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	140,237,245 - 140,243,571 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	129,803,084 - 129,809,412 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	134,231,004 - 134,238,121 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	134,228,060 - 134,238,121 (+)	Ensembl			panPan2	panpan1.1

NOC4L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	826,556 - 832,054 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	827,973 - 832,302 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	870,556 - 875,984 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	887,033 - 892,441 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	885,719 - 892,423 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	825,829 - 831,251 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	914,466 - 919,874 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	845,630 - 851,038 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Noc4l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	122,412,118 - 122,416,917 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936660	2,303,485 - 2,308,912 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936660	2,304,163 - 2,308,957 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NOC4L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	23,257,778 - 23,262,692 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	23,257,898 - 23,262,713 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	24,725,216 - 24,730,029 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NOC4L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	127,525,569 - 127,531,834 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	127,525,579 - 127,532,804 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	117,414,973 - 117,421,354 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Noc4l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	27,823,319 - 27,828,834 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	27,824,078 - 27,828,566 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Noc4l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	43,692,638 - 43,697,214 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	18
Interacting mature miRNAs:	19
Transcripts:	ENSRNOT00000056725
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

RH140900

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	46,020,355 - 46,020,549 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	52,076,469 - 52,076,662	NCBI	Rnor6.0
Rnor_5.0	12	53,814,696 - 53,814,889	UniSTS	Rnor5.0
RGSC_v3.4	12	46,164,923 - 46,165,116	UniSTS	RGSC3.4
Celera	12	47,579,085 - 47,579,278	UniSTS
RH 3.4 Map	12	804.3	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056725 ⟹ ENSRNOP00000053566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	51,675,838 - 51,680,390 (+)	Ensembl
mRatBN7.2 Ensembl	12	46,016,069 - 46,020,614 (+)	Ensembl
Rnor_6.0 Ensembl	12	52,072,188 - 52,076,739 (+)	Ensembl

RefSeq Acc Id:

NM_001014129 ⟹ NP_001014151

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	51,675,852 - 51,680,390 (+)	NCBI
mRatBN7.2	12	46,016,077 - 46,020,615 (+)	NCBI
Rnor_6.0	12	52,072,190 - 52,076,728 (+)	NCBI
Rnor_5.0	12	53,810,417 - 53,814,958 (+)	NCBI
RGSC_v3.4	12	46,160,644 - 46,165,182 (+)	RGD
Celera	12	47,574,806 - 47,579,344 (+)	RGD

Sequence:

show sequence

CGTCGGTTCCCGGGAGCAGCTGGCGGCAGCATGGAGCGGCAACCGGCATCGACGGGCTCCAGGC
AGGAGCTCGGCCGCCTGCTGGAGGCAGTACTGTCGAATCGTGGCCGGGCGAACGCGGTGTTCGA
CATCTTGGCTGTGCTTCAGTCCGAGGACCCTGAGGAGATCAAGGAAGGAGTGCGCACGTGCAGC
CGACTCTTCGGTACCTTGCTGGAGCGGGAAGAGCTGTTCGTGGGTTCGCTGCCATGCGAAGACA
TGGCCCTGGCAGGATCCCAGGGAGCCACGTACAAATACAAGGTGTGGATGAGACACCGCTACCA
CAGCTGCTGTAACCGCCTGGAGGAACTCCTGACCCATCCCTCCTTCCAGGTCAAGGAACTGGCC
CTCGAGACGCTCATGAAGTTCGTGCAGCTGGAAGGAGCGAAACCCCTGGAGAAGCCCCAGTGGG
AAAGCCACTACCTCTTCCCCCGCACACTCTTTAGGGCAGTGGTAGGAGGCCTGCTCACACCAGA
GGATGACCACAGCCTGCTTATCTCCCAGTTCTGTGAGTACTTGGAATATGACGACATCCGGTAC
CACGCAATGCAGGTGGCCACCAGCATCTTGGCGCGGGCCACCAGCCGGCAACCTGAGGTGTCAC
TCACCTTCTGGAACAACGCCTTCACGTTGCTGTCTGCTGTGAACCTACCCCTCCAAGAGCATGA
ACTCACCAACTTCTATGTGAAGCACGCACAGACATCAAGCAAGTGGAAGGTTGTTCACTTGAAG
GAGCAGAGGAAAGCTTTCCAGGAGATGTGGCTTGGCTTCCTCAAGCACAAGCTGCCCCTCAGCC
TGTACAAGAAGGTGCTGGTGGCCATGCATGACTCCATCCTACCCCACCTGGCTCAACCCACACT
CATGATCGACTTCCTCACAAGTGCTTGTGATGTGGGTGGTGCCATCAGCCTCCTGGCCTTGAAC
GGACTTTTCATCCTAATCCACAAGCATAACCTGGAGTACCCTGACTTCTATCAAAGGCTCTATG
GTCTCCTGGATCCATCCATCTTTCATGTCAAGTACCGAGCGCGCTTCTTTCACTTGGCTGACCT
CTTCCTTTCGTCCTCCCACCTCCCTGCCTACCTGGTAGCTGCCTTTGCCAAACGCCTGGCCCGG
CTGGCGCTAACAGCACCTCCTGAGGCCCTGCTTATGGTCCTGCCCTTAATCTGCAACCTGCTGC
GTAGACACCCTGCCTGCCGAGTTATGGTGCACCGCCCACAGGGCCCTGAGCTAGATGCTGATCC
ATATGACCCAACGGAGAAGGACCCAGCCAGGAGCCGTGCCTTGGAGAGCTGCCTGTGGGAACTG
CAGACCCTCCAGCAGCACTACCACCCAGAGGTGTCCAGAGCTGCCAGTGTCATCAACCAGGCAC
TCTCTGTCCCTGAGGTCAGCATCGCACCACTCCTGGAACTTACTGCATATGAGATCTTTGAGCA
GGACCTGAAGAAGATGATGCCTGAGTCTGTGCCCCTGGAGTTCATCCCAGCTAAAGGCCTGTTG
GGTCGACAGGACGACCTTTGTACTCAGTTCTTCTGTCTCAGCTGACCTGGCTGTCACTTCTCCT
AAGAAGTGCTTTTGTATGTGTGTGTGTCTGAGACAGGATCTCACTATGTGAGACTGACCTGTAC
TTGTGGTTCTCGAGCCTAAGCCTTCGCAGTACTGAGGTTACAAAGGTGCGCCACAAATAAATGG
TTTGTTTTGGTTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271550 ⟹ XP_063127620

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	51,676,089 - 51,680,392 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014151	(Get FASTA)	NCBI Sequence Viewer
	XP_063127620	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88275	(Get FASTA)	NCBI Sequence Viewer
	EDM14037	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053566
GenBank Protein	Q5I0I8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014151 ⟸ NM_001014129

- UniProtKB:

Q5I0I8 (UniProtKB/Swiss-Prot), A6J298 (UniProtKB/TrEMBL), A0A8L2QRA3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERQPASTGSRQELGRLLEAVLSNRGRANAVFDILAVLQSEDPEEIKEGVRTCSRLFGTLLERE
ELFVGSLPCEDMALAGSQGATYKYKVWMRHRYHSCCNRLEELLTHPSFQVKELALETLMKFVQL
EGAKPLEKPQWESHYLFPRTLFRAVVGGLLTPEDDHSLLISQFCEYLEYDDIRYHAMQVATSIL
ARATSRQPEVSLTFWNNAFTLLSAVNLPLQEHELTNFYVKHAQTSSKWKVVHLKEQRKAFQEMW
LGFLKHKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFLTSACDVGGAISLLALNGLFILIHKHN
LEYPDFYQRLYGLLDPSIFHVKYRARFFHLADLFLSSSHLPAYLVAAFAKRLARLALTAPPEAL
LMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDPTEKDPARSRALESCLWELQTLQQHYHPE
VSRAASVINQALSVPEVSIAPLLELTAYEIFEQDLKKMMPESVPLEFIPAKGLLGRQDDLCTQF
FCLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000053566 ⟸ ENSRNOT00000056725

RefSeq Acc Id:	XP_063127620 ⟸ XM_063271550
- Peptide Label:	isoform X1

Protein Domains

CCAAT-binding factor

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0I8-F1-model_v2	AlphaFold	Q5I0I8	1-516	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698738

Promoter ID:

EPDNEW_R9261

Type:

multiple initiation site

Name:

Noc4l_1

Description:

nucleolar complex associated 4 homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	52,072,185 - 52,072,245	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310661	AgrOrtholog
BioCyc Gene	G2FUF-18810	BioCyc
Ensembl Genes	ENSRNOG00000037478	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000056725	ENTREZGENE
IMAGE_CLONE	IMAGE:7380687	IMAGE-MGC_LOAD
InterPro	ARM-type_fold	UniProtKB/Swiss-Prot
	CCAAT-binding_factor	UniProtKB/Swiss-Prot
	Noc4	UniProtKB/Swiss-Prot
KEGG Report	rno:360828	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109121	IMAGE-MGC_LOAD
NCBI Gene	360828	ENTREZGENE
PANTHER	NUCLEOLAR COMPLEX PROTEIN 4 HOMOLOG	UniProtKB/Swiss-Prot
	PTHR12455	UniProtKB/Swiss-Prot
Pfam	CBF	UniProtKB/Swiss-Prot
PhenoGen	Noc4l	PhenoGen
RatGTEx	ENSRNOG00000037478	RatGTEx
Superfamily-SCOP	SSF48371	UniProtKB/Swiss-Prot
UniProt	A0A8L2QRA3	ENTREZGENE, UniProtKB/TrEMBL
	A6J298	ENTREZGENE, UniProtKB/TrEMBL
	NOC4L_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-09	Noc4l	nucleolar complex associated 4 homolog	Noc4l	nucleolar complex associated 4 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Noc4l	nucleolar complex associated 4 homolog (S. cerevisiae)	RGD1310661	similar to hypothetical protein MGC28606	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310661	similar to hypothetical protein MGC28606	RGD1310661_predicted	similar to hypothetical protein MGC28606 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310661_predicted	similar to hypothetical protein MGC28606 (predicted)	LOC360828_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC360828_predicted	similar to hypothetical protein MGC28606 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message