Advanced Search (OLGA)

Gene: Pdcd5 (programmed cell death 5) Rattus norvegicus

Analyze

Symbol:

Pdcd5

Name:

programmed cell death 5

RGD ID:

1310561

Description:

Predicted to enable acetyltransferase activator activity; beta-tubulin binding activity; and heparin binding activity. Predicted to be involved in several processes, including cellular response to transforming growth factor beta stimulus; negative regulation of protein folding; and positive regulation of apoptotic process. Predicted to be active in cytosol and nucleus. Orthologous to human PDCD5 (programmed cell death 5); INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC292814; NEWGENE_1310561; programmed cell death protein 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDCD5 (programmed cell death 5)	RGD	RGD
Mus musculus (house mouse):	Pdcd5 (programmed cell death 5)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Pdcd5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDCD5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDCD5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdcd5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDCD5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDCD5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdcd5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pdcd5 (programmed cell death 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PDCD5 (programmed cell death 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdcd5 (programmed cell death 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdcd5 (programmed cell death 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	pdcd5 (programmed cell death 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdcd5 (programmed cell death 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	D2005.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	PDCD-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	PDCD-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SDD2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SDD2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pdcd5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pdcd5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	97,442,755 - 97,448,084 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	97,442,755 - 97,449,844 (-)	Ensembl				GRCr8
mRatBN7.2	1	88,305,869 - 88,311,200 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	88,305,869 - 88,311,200 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	93,710,710 - 93,716,017 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	3,949,014 - 3,954,316 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	95,468,996 - 95,474,303 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	91,173,473 - 91,178,801 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	91,173,473 - 91,178,801 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	1	91,961,020 - 91,966,418 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	93,092,982 - 93,098,394 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	88,194,319 - 88,199,647 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	82,653,624 - 82,658,741 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

avobenzone (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

cadmium dichloride (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

L-methionine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

morphine (EXP)

motexafin gadolinium (ISO)

nickel dichloride (EXP)

p-menthan-3-ol (ISO)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

raloxifene (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

vorinostat (ISO)

zinc acetate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cellular response to transforming growth factor beta stimulus (ISO)

negative regulation of protein folding (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of gene expression (ISO)

regulation of apoptotic process (ISO)

Cellular Component

cytosol (IBA)

nucleus (IBA,ISO)

Molecular Function

acetyltransferase activator activity (ISO)

beta-tubulin binding (ISO)

DNA binding (IEA)

heparin binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9920759	PMID:16374546	PMID:16791210	PMID:17165023	PMID:20458337	PMID:23638963	PMID:24012345	PMID:24375412	PMID:24614334	PMID:28131823	PMID:31505169	PMID:34936294

Genomics

Comparative Map Data

Pdcd5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	97,442,755 - 97,448,084 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	97,442,755 - 97,449,844 (-)	Ensembl				GRCr8
mRatBN7.2	1	88,305,869 - 88,311,200 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	88,305,869 - 88,311,200 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	93,710,710 - 93,716,017 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	3,949,014 - 3,954,316 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	95,468,996 - 95,474,303 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	91,173,473 - 91,178,801 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	91,173,473 - 91,178,801 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	1	91,961,020 - 91,966,418 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	93,092,982 - 93,098,394 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	88,194,319 - 88,199,647 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	82,653,624 - 82,658,741 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

PDCD5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	32,581,190 - 32,587,453 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	32,581,188 - 32,587,453 (+)	Ensembl			hg38	GRCh38
GRCh37	19	33,072,096 - 33,078,359 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	37,763,944 - 37,770,171 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	37,763,943 - 37,770,167	NCBI
Celera	19	29,765,756 - 29,771,983 (+)	NCBI		Celera
Cytogenetic Map	19	q13.11	NCBI
HuRef	19	29,575,130 - 29,581,395 (+)	NCBI		HuRef
CHM1_1	19	33,073,187 - 33,079,450 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	35,099,955 - 35,106,218 (+)	NCBI		T2T-CHM13v2.0

Pdcd5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	35,341,410 - 35,346,907 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	35,341,407 - 35,346,946 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	35,641,985 - 35,647,482 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	35,641,982 - 35,647,521 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	36,427,004 - 36,432,501 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	35,350,745 - 35,356,242 (-)	NCBI		MGSCv36	mm8
MGSCv36	7	26,142,102 - 26,147,599 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	7	B2	NCBI
cM Map	7	21.37	NCBI

Pdcd5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	5,365,137 - 5,372,888 (-)	Ensembl
ChiLan1.0	NW_004955468	5,365,137 - 5,372,888 (-)	NCBI	ChiLan1.0	ChiLan1.0

PDCD5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	38,553,653 - 38,560,000 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	40,550,500 - 40,556,799 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	29,500,983 - 29,507,277 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	38,248,576 - 38,254,918 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	38,248,576 - 38,254,909 (+)	Ensembl			panPan2	panpan1.1

PDCD5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	119,379,427 - 119,384,664 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	119,379,431 - 119,384,550 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	118,779,041 - 118,785,127 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	119,980,793 - 119,986,937 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	119,980,797 - 119,986,923 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	119,543,621 - 119,549,643 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	119,163,363 - 119,169,456 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	120,223,648 - 120,229,734 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pdcd5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	8,513,908 - 8,542,659 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	3,102,949 - 3,109,499 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	3,103,223 - 3,109,399 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDCD5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	42,483,449 - 42,491,591 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	42,483,653 - 42,491,589 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	37,992,740 - 38,000,670 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDCD5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	27,633,604 - 27,639,766 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	27,633,621 - 27,639,794 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	5,204,901 - 5,211,184 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdcd5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	7,482,401 - 7,491,561 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pdcd5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	163,018,465 - 163,023,842 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pdcd5
18 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	72
Count of miRNA genes:	55
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000017708, ENSRNOT00000074804
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

D1Rat341

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	97,443,521 - 97,443,748 (+)	Marker Load Pipeline
mRatBN7.2	1	88,306,635 - 88,306,864 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	91,961,784 - 91,962,094	NCBI	Rnor6.0
Rnor_6.0	1	91,174,240 - 91,174,466	NCBI	Rnor6.0
Rnor_5.0	1	93,093,749 - 93,094,059	UniSTS	Rnor5.0
Rnor_5.0	1	92,304,677 - 92,304,903	UniSTS	Rnor5.0
RGSC_v3.4	1	88,195,086 - 88,195,312	UniSTS	RGSC3.4
RGSC_v3.4	1	88,195,085 - 88,195,312	RGD	RGSC3.4
RGSC_v3.1	1	88,273,196 - 88,273,423	RGD
RH 3.4 Map	1	871.2	RGD
RH 3.4 Map	1	871.2	UniSTS
RH 2.0 Map	1	568.3	RGD
SHRSP x BN Map	1	43.3699	RGD
FHH x ACI Map	1	46.63	RGD
Cytogenetic Map	1	q21	UniSTS

D1Got89

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	88,306,663 - 88,306,859 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	91,961,812 - 91,962,089	NCBI	Rnor6.0
Rnor_6.0	1	91,174,268 - 91,174,461	NCBI	Rnor6.0
Rnor_5.0	1	93,093,777 - 93,094,054	UniSTS	Rnor5.0
Rnor_5.0	1	92,304,705 - 92,304,898	UniSTS	Rnor5.0
RGSC_v3.4	1	88,195,114 - 88,195,307	UniSTS	RGSC3.4
RGSC_v3.4	1	88,195,113 - 88,195,307	RGD	RGSC3.4
RGSC_v3.1	1	88,273,225 - 88,273,418	RGD
RH 3.4 Map	1	884.2	UniSTS
RH 3.4 Map	1	884.2	RGD
RH 2.0 Map	1	572.7	RGD
Cytogenetic Map	1	q21	UniSTS

RH137054

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	88,305,932 - 88,306,369 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	91,961,081 - 91,961,517	NCBI	Rnor6.0
Rnor_6.0	1	91,173,537 - 91,173,973	NCBI	Rnor6.0
Rnor_5.0	1	93,093,046 - 93,093,482	UniSTS	Rnor5.0
Rnor_5.0	1	92,303,974 - 92,304,410	UniSTS	Rnor5.0
RGSC_v3.4	1	88,194,383 - 88,194,819	UniSTS	RGSC3.4
Celera	1	82,653,688 - 82,654,124	UniSTS
RH 3.4 Map	15	459.6	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
21	7	34	122	79	74	41	89	41	12	292	163	11	93	63	84	33	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017708 ⟹ ENSRNOP00000017708

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	97,442,755 - 97,448,084 (-)	Ensembl
mRatBN7.2 Ensembl	1	88,305,869 - 88,311,200 (-)	Ensembl
Rnor_6.0 Ensembl	1	91,173,473 - 91,178,801 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000074804 ⟹ ENSRNOP00000066699

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	97,442,755 - 97,447,957 (-)	Ensembl
mRatBN7.2 Ensembl	1	88,305,869 - 88,311,073 (-)	Ensembl
Rnor_6.0 Ensembl	1	91,961,020 - 91,966,418 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151033 ⟹ ENSRNOP00000110667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	97,442,755 - 97,449,844 (-)	Ensembl

RefSeq Acc Id:

NM_001106247 ⟹ NP_001099717

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	97,442,755 - 97,448,084 (-)	NCBI
mRatBN7.2	1	88,305,869 - 88,311,200 (-)	NCBI
Rnor_6.0	1	91,173,473 - 91,178,801 (-)	NCBI
Rnor_5.0	1	93,092,982 - 93,098,394 (-)	NCBI
RGSC_v3.4	1	88,194,319 - 88,199,647 (-)	RGD
Celera	1	82,653,624 - 82,658,741 (-)	RGD

Sequence:

show sequence

GCGCAGTAAAAGGCGCCGTGCTCGAGTCTCAGGCTGAAGCGATTCCAACCGAGTGTACCGGAGG
GCCGGTGCGGCTGCGCGACCACCCGACGGCCGCTGCGCCTGCGCGACGTTGGACAGCCGCGCCA
TGGCGGACGAAGAACTCGAGGCGCTGAGAAAGCAGAGGCTGGCCGAGCTGCAGGCCAAGCACGG
AGATCCTGGTGATGCAGCCCAACAGGAAGCAAAACAAAGGGAAGCAGAAATGAGAAACAGTATC
TTAGCCCAAGTTCTGGATCAGTCAGCCCGGGCCAGGTTAAGTAACTTAGCACTTGTGAAGCCTG
AGAAAACGAAAGCAGTGGAGAACTACCTTATACAGATGGCACGGTATGGACAGCTGAGTGGGAA
GGTGTCAGAACAAGGGTTAATAGAAATACTCGAGAAAGTCAGCCAACAGACAGAAAAGAAAACA
ACAGTGAAATTCAACAGAAGAAAAGTAATGGACTCAGATGAAGATGATGATTACTAAAGAGGAC
GTGCTTAGACAGACCCACGGAGCAGGTCTAGGACAGTTACCACCTGTAAATGTTTACTTTGTTC
CCTGTCTATATGCCTTTTGAAAAAAATAAACTTGTACCTCAAACTCAAACAGTTTGGGTGTCTC
AGAATCCCAGGCACTTC

hide sequence

RefSeq Acc Id:

XM_006228897 ⟹ XP_006228959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	97,442,787 - 97,447,828 (-)	NCBI
mRatBN7.2	1	88,305,901 - 88,310,972 (-)	NCBI
Rnor_6.0	1	91,173,505 - 91,178,583 (-)	NCBI

Sequence:

show sequence

CTCACCCCAAGCAAAGGCTCTCAGCGTTTGCTCGTGGGCCACAGGCTCCTGGGAACCCCATGGC
TCCGTGTGCACGGGCGGGGGTGGGGTGTTCCCGGAGGCCGTCGCAGCCTCCTCGGTTCCCGTAG
AGTCCCGCGTGAGGCTCGTGCGGGTTGGGGTGTGCGCGCCCTCGAGTCACCCCCAAGTCTCGGT
TTTCGCTGCCGTCGAGCCTCAAGCTAGCCCCGCCGGGATTGGGGTGTCCTCGGATTGGGTCTTG
CTGGCCGGAAGTCAGCGCTGTATAGAGGGGACTCTTCTGAGCTCTGGTGCGGAGGACGCCGCTC
TGACGGCGCGTCCCTAGGCGGGAGTCAAACCGCGGACTCCAGAGATGGATCCTGGTGATGCAGC
CCAACAGGAAGCAAAACAAAGGGAAGCAGAAATGAGAAACAGTATCTTAGCCCAAGTTCTGGAT
CAGTCAGCCCGGGCCAGGTTAAGTAACTTAGCACTTGTGAAGCCTGAGAAAACGAAAGCAGTGG
AGAACTACCTTATACAGATGGCACGGTATGGACAGCTGAGTGGGAAGGTGTCAGAACAAGGGTT
AATAGAAATACTCGAGAAAGTCAGCCAACAGACAGAAAAGAAAACAACAGTGAAATTCAACAGA
AGAAAAGTAATGGACTCAGATGAAGATGATGATTACTAAAGAGGACGTGCTTAGACAGACCCAC
GGAGCAGGTCTAGGACAGTTACCACCTGTAAATGTTTACTTTGTTCCCTGTCTATATGCCTTTT
GAAAAAAATAAACTTGTACCTCAAACTCAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099717	(Get FASTA)	NCBI Sequence Viewer
	XP_006228959	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07610	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017708
	ENSRNOP00000017708.5
	ENSRNOP00000066699.2
	ENSRNOP00000110667.1

RefSeq Acc Id:	NP_001099717 ⟸ NM_001106247
- UniProtKB:	D4ADF5 (UniProtKB/TrEMBL), A6JAC3 (UniProtKB/TrEMBL), M0RAY1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADEELEALRKQRLAELQAKHGDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKP EKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRRKVMDSDEDDDY hide sequence

RefSeq Acc Id:	XP_006228959 ⟸ XM_006228897
- Peptide Label:	isoform X1
- Sequence:	show sequence MDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSG KVSEQGLIEILEKVSQQTEKKTTVKFNRRKVMDSDEDDDY hide sequence

Ensembl Acc Id:

ENSRNOP00000066699 ⟸ ENSRNOT00000074804

Ensembl Acc Id:

ENSRNOP00000017708 ⟸ ENSRNOT00000017708

Ensembl Acc Id:

ENSRNOP00000110667 ⟸ ENSRNOT00000151033

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ADF5-F1-model_v2	AlphaFold	D4ADF5	1-125	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689961

Promoter ID:

EPDNEW_R486

Type:

initiation region

Name:

Pdcd5_1

Description:

programmed cell death 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	91,178,778 - 91,178,838	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310561	AgrOrtholog
BioCyc Gene	G2FUF-59966	BioCyc
Ensembl Genes	ENSRNOG00000013250	Ensembl
	ENSRNOG00000050827	Ensembl
	ENSRNOG00000068327	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017708	ENTREZGENE
	ENSRNOT00000017708.7	UniProtKB/TrEMBL
	ENSRNOT00000074804.4	UniProtKB/TrEMBL
	ENSRNOT00000151033.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.140	UniProtKB/TrEMBL
InterPro	PDCD5-like_sf	UniProtKB/TrEMBL
	TFAR19_DNA-bd	UniProtKB/TrEMBL
KEGG Report	rno:292814	UniProtKB/TrEMBL
NCBI Gene	292814	ENTREZGENE
PANTHER	PROGRAMMED CELL DEATH PROTEIN 5	UniProtKB/TrEMBL
	TFAR19_DNA_bd	UniProtKB/TrEMBL
Pfam	dsDNA_bind	UniProtKB/TrEMBL
PhenoGen	Pdcd5	PhenoGen
PIRSF	TFAR19	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013250	RatGTEx
	ENSRNOG00000050827	RatGTEx
	ENSRNOG00000068327	RatGTEx
Superfamily-SCOP	TFAR19-related	UniProtKB/TrEMBL
UniProt	A0ABK0M823_RAT	UniProtKB/TrEMBL
	A6JAC3	ENTREZGENE, UniProtKB/TrEMBL
	D4ADF5	ENTREZGENE, UniProtKB/TrEMBL
	M0RAY1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pdcd5	programmed cell death 5	NEWGENE_1310561	programmed cell death 5	Data merged from RGD:11480964	737654	PROVISIONAL
2016-08-02	NEWGENE_1310561	programmed cell death 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Pdcd5	programmed cell death 5	Pdcd5_predicted	programmed cell death 5 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pdcd5_predicted	programmed cell death 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message