Advanced Search (OLGA)

Gene: Nit2 (nitrilase family, member 2) Rattus norvegicus

Analyze

Symbol:

Nit2

Name:

nitrilase family, member 2

RGD ID:

1310494

Description:

Predicted to enable omega-amidase activity. Predicted to be involved in asparagine metabolic process; glutamine metabolic process; and oxaloacetate metabolic process. Predicted to be located in cytoplasm. Orthologous to human NIT2 (nitrilase family member 2); PARTICIPATES IN alanine, aspartate and glutamate metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC288174; MGC124762; Nit protein 2; nitrilase homolog 2; omega-amidase NIT2; RGD1310494; similar to Nit protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NIT2 (nitrilase family member 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nit2 (nitrilase family, member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nit2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NIT2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NIT2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nit2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NIT2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NIT2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nit2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nit2 (nitrilase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NIT2 (nitrilase family member 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nit2 (nitrilase family, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nit2 (nitrilase family, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NIT3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8132	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nit2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	56,832,957 - 56,844,142 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	56,832,558 - 56,844,141 (+)	Ensembl				GRCr8
mRatBN7.2	11	43,363,839 - 43,378,713 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	43,363,985 - 43,375,024 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	52,139,097 - 52,149,930 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	44,800,701 - 44,811,534 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	43,924,795 - 43,935,628 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	45,462,345 - 45,473,107 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	45,462,345 - 45,473,104 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	48,655,096 - 48,665,858 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	44,287,827 - 44,298,589 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	43,153,636 - 43,164,398 (+)	NCBI		Celera
RGSC_v3.1	11	44,345,401 - 44,356,395 (+)	NCBI
Cytogenetic Map	11	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aconitine (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (EXP)

cocaine (ISO)

DDE (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

endosulfan (EXP)

etoposide (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

isotretinoin (ISO)

ivermectin (ISO)

methidathion (ISO)

microcystin RR (ISO)

N-nitrosodiethylamine (EXP)

nimesulide (EXP)

nitrofen (EXP)

Nutlin-3 (ISO)

ochratoxin A (EXP)

paracetamol (EXP,ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

Propiverine (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (EXP)

sodium dichromate (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

asparagine metabolic process (IBA,IEA,ISO)

glutamine metabolic process (IBA,IEA,ISO)

oxaloacetate metabolic process (IBA,IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IEA,ISO)

mitochondrion (ISO)

Molecular Function

2-oxoglutaramate amidase activity (IEA)

hydrolase activity (IEA)

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides (IEA)

omega-amidase activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alanine, aspartate and glutamate metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14651853	PMID:19056867	PMID:19595734	PMID:22674578	PMID:23376485	PMID:26316108	PMID:34800366

Genomics

Comparative Map Data

Nit2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	56,832,957 - 56,844,142 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	56,832,558 - 56,844,141 (+)	Ensembl				GRCr8
mRatBN7.2	11	43,363,839 - 43,378,713 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	43,363,985 - 43,375,024 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	52,139,097 - 52,149,930 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	44,800,701 - 44,811,534 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	43,924,795 - 43,935,628 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	45,462,345 - 45,473,107 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	45,462,345 - 45,473,104 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	48,655,096 - 48,665,858 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	44,287,827 - 44,298,589 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	43,153,636 - 43,164,398 (+)	NCBI		Celera
RGSC_v3.1	11	44,345,401 - 44,356,395 (+)	NCBI
Cytogenetic Map	11	q12	NCBI

NIT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	100,334,757 - 100,361,635 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	100,334,625 - 100,361,635 (+)	Ensembl			hg38	GRCh38
GRCh37	3	100,053,601 - 100,080,479 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	101,536,258 - 101,556,883 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	101,536,257 - 101,556,881	NCBI
Celera	3	98,444,355 - 98,465,336 (+)	NCBI		Celera
Cytogenetic Map	3	q12.2	NCBI
HuRef	3	97,421,355 - 97,442,271 (+)	NCBI		HuRef
CHM1_1	3	100,016,590 - 100,037,506 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	103,040,105 - 103,066,978 (+)	NCBI		T2T-CHM13v2.0

Nit2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	56,977,028 - 56,987,695 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	56,977,028 - 56,987,704 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	57,156,665 - 57,167,332 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	57,156,665 - 57,167,341 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	57,156,778 - 57,167,445 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	57,078,024 - 57,088,691 (-)	NCBI		MGSCv36	mm8
Celera	16	57,490,001 - 57,500,718 (-)	NCBI		Celera
Cytogenetic Map	16	C1.1	NCBI
cM Map	16	34.22	NCBI

Nit2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	1,856,794 - 1,866,596 (+)	Ensembl
ChiLan1.0	NW_004955427	1,856,794 - 1,867,545 (+)	NCBI	ChiLan1.0	ChiLan1.0

NIT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	98,277,630 - 98,298,407 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	98,282,455 - 98,303,191 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	97,427,470 - 97,448,354 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	104,109,805 - 104,130,535 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	104,109,804 - 104,130,535 (+)	Ensembl			panPan2	panpan1.1

NIT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	6,944,340 - 6,960,540 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	6,944,374 - 6,959,074 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	7,099,859 - 7,116,011 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	7,083,214 - 7,099,449 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	7,083,156 - 7,099,435 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	6,971,024 - 6,987,109 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	7,019,085 - 7,035,461 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	7,348,943 - 7,365,280 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nit2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	150,046,553 - 150,065,487 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936630	2,943,121 - 2,963,367 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936630	2,944,447 - 2,963,339 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NIT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	158,630,913 - 158,653,147 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	158,630,997 - 158,653,164 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	168,425,785 - 168,445,894 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NIT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	80,524,856 - 80,545,615 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	80,524,860 - 80,542,148 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	86,028,430 - 86,048,371 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nit2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624789	13,754,605 - 13,778,366 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624789	13,754,573 - 13,778,368 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nit2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	41,267,936 - 41,278,651 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nit2
33 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	130
Count of miRNA genes:	101
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000029420
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
11528648	Bss118	Bone structure and strength QTL 118	6.658	2e-07	femur strength trait (VT:0010010)	femur ultimate displacement (CMO:0002719)	11	54107987	56845449	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	29958996	57754989	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1600394	Edcs1	Endometrial carcinoma susceptibility QTL1	2.9	0.04	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	11	12823152	57823152	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

RH129060

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,374,544 - 43,374,740 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,472,879 - 45,473,074	NCBI	Rnor6.0
Rnor_5.0	11	48,665,630 - 48,665,825	UniSTS	Rnor5.0
RGSC_v3.4	11	44,298,361 - 44,298,556	UniSTS	RGSC3.4
Celera	11	43,164,170 - 43,164,365	UniSTS
RH 3.4 Map	11	321.6	UniSTS
Cytogenetic Map	11	q12	UniSTS

RH129862

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,374,715 - 43,374,929 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,473,050 - 45,473,263	NCBI	Rnor6.0
Rnor_5.0	11	48,665,801 - 48,666,014	UniSTS	Rnor5.0
RGSC_v3.4	11	44,298,532 - 44,298,745	UniSTS	RGSC3.4
Celera	11	43,164,341 - 43,164,554	UniSTS
RH 3.4 Map	11	324.6	UniSTS
Cytogenetic Map	11	q12	UniSTS

RH132479

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,374,809 - 43,374,989 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,473,144 - 45,473,323	NCBI	Rnor6.0
Rnor_5.0	11	48,665,895 - 48,666,074	UniSTS	Rnor5.0
RGSC_v3.4	11	44,298,626 - 44,298,805	UniSTS	RGSC3.4
Celera	11	43,164,435 - 43,164,614	UniSTS
RH 3.4 Map	11	321.6	UniSTS
Cytogenetic Map	11	q12	UniSTS

AI411100

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,374,577 - 43,374,740 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,472,912 - 45,473,074	NCBI	Rnor6.0
Rnor_5.0	11	48,665,663 - 48,665,825	UniSTS	Rnor5.0
RGSC_v3.4	11	44,298,394 - 44,298,556	UniSTS	RGSC3.4
Celera	11	43,164,203 - 43,164,365	UniSTS
RH 3.4 Map	11	325.8	UniSTS
Cytogenetic Map	11	q12	UniSTS

RH136262

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,362,672 - 43,362,889 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	28,447,532 - 28,447,820 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	27,947,229 - 27,947,516	NCBI	Rnor6.0
Rnor_6.0	11	45,461,007 - 45,461,223	NCBI	Rnor6.0
Rnor_5.0	11	48,653,758 - 48,653,974	UniSTS	Rnor5.0
Rnor_5.0	2	47,058,118 - 47,058,405	UniSTS	Rnor5.0
RGSC_v3.4	2	27,611,987 - 27,612,274	UniSTS	RGSC3.4
RGSC_v3.4	11	44,286,489 - 44,286,705	UniSTS	RGSC3.4
Celera	11	43,152,298 - 43,152,514	UniSTS
Celera	2	24,489,450 - 24,489,737	UniSTS
Cytogenetic Map	11	q12	UniSTS
Cytogenetic Map	2	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC082034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000029420 ⟹ ENSRNOP00000034144

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,833,070 - 56,844,140 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,363,985 - 43,375,023 (+)	Ensembl
Rnor_6.0 Ensembl	11	45,462,345 - 45,473,104 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098488 ⟹ ENSRNOP00000084321

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,833,597 - 56,844,141 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,364,502 - 43,375,023 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105850 ⟹ ENSRNOP00000078811

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,834,009 - 56,844,141 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,364,891 - 43,375,023 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114192 ⟹ ENSRNOP00000077766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,833,057 - 56,844,141 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,364,003 - 43,375,024 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127033 ⟹ ENSRNOP00000103031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,832,558 - 56,844,141 (+)	Ensembl

RefSeq Acc Id:

NM_001034126 ⟹ NP_001029298

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,833,129 - 56,843,891 (+)	NCBI
mRatBN7.2	11	43,364,011 - 43,374,773 (+)	NCBI
Rnor_6.0	11	45,462,345 - 45,473,107 (+)	NCBI
Rnor_5.0	11	48,655,096 - 48,665,858 (+)	NCBI
RGSC_v3.4	11	44,287,827 - 44,298,589 (+)	RGD
Celera	11	43,153,636 - 43,164,398 (+)	RGD

Sequence:

show sequence

CTGGCTGCAGTCCTTGCGGCGTCTGGCGCTCCGGGGAAGAGCCATGTCTACTTTCCGCCTGGCC
CTCATCCAGCTTCAGGTTTCTTCCATTAAATCAGATAACATTACCCGGGCTTGTAGCCTAGTCC
GGGAGGCAGCAAAGCAAGGTGCCAACATAGTTTCTCTGCCGGAGTGCTTCAATTCTCCATATGG
AACTAACTACTTTCCTGAATACGCAGAGAAGATTCCTGGAGAGTCCACAAAGAAGCTTTCTGAA
GTCGCAAAGGAGAACAGCATATACCTCATTGGAGGCTCCATCCCAGAAGAGGATGATGGGAAAC
TGTATAATACCTGCGCTGTGTTTGGGCCTGATGGAAATTTACTGGTAAAGCACAGAAAGATCCA
TCTGTTTGACATTGATGTTCCTGGGAAAATTACATTTCAAGAATCCAAAACACTGAGTCCTGGT
GATAGTTTCTCCACGTTTGATACCCCTTACTGCAGAGTGGGCCTGGGCATCTGCTACGATATGC
GCTTCGCAGAGCTTGCACAAATCTATGCACGAAGAGGCTGCCAGCTCTTGGTGTATCCTGGAGC
TTTCAATATGACCACTGGACCAGCCCACTGGGAGTTGCTTCAGCGAGCCCGAGCTGTTGATAAT
CAGGTGTATGTGGCTACAGCCTCTCCTGCCCGGGATGAGAAAGCCTCGTACGTGGCCTGGGGAC
ACAGCACTGTGGTGGATCCTTGGGGGCAGGTCCTAACCAAAGCTGGCACCGAGGAAACAATCCT
GTACTCAGACATAGACCTGAAGAAGCTGTCTGAAATTCGGCAGCAAATTCCCATTTTAAAACAG
AAACGAGCAGACCTCTATTCAGTGGAGTCAAAGAAGCCTTAATGGCTTTCTAACCTGTCACAAG
CAGAATGATGTTCTGTAAGACGAGCAACTCTACCACTCTACCAAATCATTTTTGGGATAGGGCC
CTTTCATGTTAATTCTACCAATGATCTGTGACACCAGGCCCCCTATTTTAATTAAAAGATCCGT
CTTCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039088193 ⟹ XP_038944121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,832,957 - 56,844,142 (+)	NCBI
mRatBN7.2	11	43,363,839 - 43,375,024 (+)	NCBI

RefSeq Acc Id:

XM_039088194 ⟹ XP_038944122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,832,957 - 56,844,142 (+)	NCBI
mRatBN7.2	11	43,363,839 - 43,378,713 (+)	NCBI

RefSeq Acc Id:

XM_063270409 ⟹ XP_063126479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,833,072 - 56,844,142 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029298	(Get FASTA)	NCBI Sequence Viewer
	XP_038944121	(Get FASTA)	NCBI Sequence Viewer
	XP_038944122	(Get FASTA)	NCBI Sequence Viewer
	XP_063126479	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00638	(Get FASTA)	NCBI Sequence Viewer
	EDM11034	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000034144
	ENSRNOP00000078811
GenBank Protein	Q497B0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001029298 ⟸ NM_001034126

- UniProtKB:

Q497B0 (UniProtKB/Swiss-Prot), A6IQN1 (UniProtKB/TrEMBL), A0A8I5ZM02 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSTFRLALIQLQVSSIKSDNITRACSLVREAAKQGANIVSLPECFNSPYGTNYFPEYAEKIPGE
STKKLSEVAKENSIYLIGGSIPEEDDGKLYNTCAVFGPDGNLLVKHRKIHLFDIDVPGKITFQE
SKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYARRGCQLLVYPGAFNMTTGPAHWELLQ
RARAVDNQVYVATASPARDEKASYVAWGHSTVVDPWGQVLTKAGTEETILYSDIDLKKLSEIRQ
QIPILKQKRADLYSVESKKP

hide sequence

Ensembl Acc Id:

ENSRNOP00000034144 ⟸ ENSRNOT00000029420

RefSeq Acc Id:	XP_038944122 ⟸ XM_039088194
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2QJE6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038944121 ⟸ XM_039088193
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QJE6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084321 ⟸ ENSRNOT00000098488

Ensembl Acc Id:

ENSRNOP00000078811 ⟸ ENSRNOT00000105850

Ensembl Acc Id:

ENSRNOP00000077766 ⟸ ENSRNOT00000114192

RefSeq Acc Id:	XP_063126479 ⟸ XM_063270409
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I5ZM02 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000103031 ⟸ ENSRNOT00000127033

Protein Domains

CN hydrolase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q497B0-F1-model_v2	AlphaFold	Q497B0	1-276	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698109

Promoter ID:

EPDNEW_R8634

Type:

initiation region

Name:

Nit2_1

Description:

nitrilase family, member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	45,462,333 - 45,462,393	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310494	AgrOrtholog
BioCyc Gene	G2FUF-21538	BioCyc
Ensembl Genes	ENSRNOG00000027797	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000029420	ENTREZGENE
	ENSRNOT00000105850	ENTREZGENE
Gene3D-CATH	3.60.110.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5621093	IMAGE-MGC_LOAD
	IMAGE:7130857	IMAGE-MGC_LOAD
InterPro	C-N_Hydrolase	UniProtKB/Swiss-Prot
	C-N_Hydrolase_sf	UniProtKB/Swiss-Prot
	Nit1/2_C-N_Hydrolase	UniProtKB/Swiss-Prot
KEGG Report	rno:288174	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124762	IMAGE-MGC_LOAD
	MGC:95171	IMAGE-MGC_LOAD
NCBI Gene	288174	ENTREZGENE
PANTHER	NITRILASE-RELATED	UniProtKB/Swiss-Prot
	OMEGA-AMIDASE NIT2	UniProtKB/Swiss-Prot
Pfam	CN_hydrolase	UniProtKB/Swiss-Prot
PhenoGen	Nit2	PhenoGen
PROSITE	CN_HYDROLASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000027797	RatGTEx
Superfamily-SCOP	SSF56317	UniProtKB/Swiss-Prot
UniProt	A0A8I5YCH4_RAT	UniProtKB/TrEMBL
	A0A8I5ZM02	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A112_RAT	UniProtKB/TrEMBL
	A0A8L2QJE6	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LHT0_RAT	UniProtKB/TrEMBL
	A6IQN1	ENTREZGENE, UniProtKB/TrEMBL
	NIT2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Nit2	nitrilase family, member 2	RGD1310494	similar to Nit protein 2	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310494	similar to Nit protein 2	RGD1310494_predicted	similar to Nit protein 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310494_predicted	similar to Nit protein 2 (predicted)	LOC288174_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC288174_predicted	similar to Nit protein 2 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)