Symbol:
Tfap2a
Name:
transcription factor AP-2 alpha
RGD ID:
1310267
Description:
Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; identical protein binding activity; and transcription coregulator activity. Involved in Schwann cell development; positive regulation of transcription by RNA polymerase II; and response to lipopolysaccharide. Predicted to be located in clathrin-coated pit and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in branchiooculofacial syndrome. Orthologous to human TFAP2A (transcription factor AP-2 alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
activating enhancer-binding protein 2 alpha; activating enhancer-binding protein 2-alpha; activator protein 2; AP-2 transcription factor; AP2-alpha; LOC306862; Tcfap2a; transcription factor AP-2, alpha; transcription factor AP-2-alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 24,230,064 - 24,253,219 (+) NCBI GRCr8 mRatBN7.2 17 24,028,716 - 24,047,507 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 24,024,432 - 24,047,507 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 23,913,439 - 23,929,006 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 25,516,916 - 25,532,497 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 23,854,421 - 23,869,994 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 24,653,342 - 24,670,457 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 24,654,902 - 24,670,457 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 26,596,839 - 26,634,214 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 30,017,580 - 30,034,852 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 30,020,346 - 30,035,192 (+) NCBI Celera 17 23,700,225 - 23,715,767 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tfap2a Rat (-)-demecolcine decreases expression ISO TFAP2A (Homo sapiens) 6480464 Demecolcine results in decreased expression of TFAP2A mRNA CTD PMID:23649840 Tfap2a Rat 1,2-dimethylhydrazine increases expression ISO Tfap2a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TFAP2A mRNA CTD PMID:22206623 Tfap2a Rat 14-Deoxy-11,12-didehydroandrographolide increases expression ISO TFAP2A (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in increased expression of TFAP2A mRNA CTD PMID:22101062 Tfap2a Rat 15-acetyldeoxynivalenol increases expression ISO TFAP2A (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of TFAP2A mRNA CTD PMID:23792671 Tfap2a Rat 17beta-estradiol decreases expression ISO TFAP2A (Homo sapiens) 6480464 Estradiol results in decreased expression of TFAP2A mRNA CTD PMID:26865669 and PMID:28711546 Tfap2a Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO TFAP2A (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Tfap2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tfap2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TFAP2A mRNA CTD PMID:21570461 and PMID:24058054 Tfap2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TFAP2A mRNA CTD PMID:33387578 Tfap2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TFAP2A (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TFAP2A mRNA CTD PMID:19901195 more ... Tfap2a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tfap2a (Mus musculus) 6480464 TFAP2A mRNA affects the reaction [Tetrachlorodibenzodioxin results in increased degradation of AHR protein] CTD PMID:16085934 Tfap2a Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO TFAP2A (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of TFAP2A mRNA CTD PMID:31326446 Tfap2a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Tfap2a (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of TFAP2A mRNA and Acrylamide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of TFAP2A mRNA] CTD PMID:30409764 Tfap2a Rat 4,4'-sulfonyldiphenol decreases expression ISO Tfap2a (Mus musculus) 6480464 bisphenol S results in decreased expression of TFAP2A mRNA CTD PMID:30951980 Tfap2a Rat 4,4'-sulfonyldiphenol decreases methylation ISO Tfap2a (Mus musculus) 6480464 bisphenol S results in decreased methylation of TFAP2A promoter CTD PMID:33297965 Tfap2a Rat 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine increases expression ISO Tfap2a (Mus musculus) 6480464 fenpropimorph results in increased expression of TFAP2A protein CTD PMID:34737147 Tfap2a Rat 4-hydroxyphenyl retinamide increases expression ISO Tfap2a (Mus musculus) 6480464 Fenretinide results in increased expression of TFAP2A mRNA CTD PMID:28973697 Tfap2a Rat 5-aza-2'-deoxycytidine increases expression ISO TFAP2A (Homo sapiens) 6480464 Decitabine results in increased expression of TFAP2A mRNA and Decitabine results in increased expression of TFAP2A protein CTD PMID:16204029 Tfap2a Rat 5-aza-2'-deoxycytidine multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [Decitabine results in increased expression of TFAP2A protein] which results in increased susceptibility to Cisplatin and [Decitabine results in increased expression of TFAP2A protein] which results in increased susceptibility to Doxorubicin CTD PMID:16204029 Tfap2a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TFAP2A mRNA CTD PMID:24780913 Tfap2a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TFAP2A mRNA CTD PMID:30047161 Tfap2a Rat acrylamide multiple interactions ISO Tfap2a (Mus musculus) 6480464 Acrylamide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of TFAP2A mRNA] and Acrylamide promotes the reaction [Dietary Fats results in increased expression of TFAP2A mRNA] CTD PMID:30409764 Tfap2a Rat afimoxifene decreases expression ISO TFAP2A (Homo sapiens) 6480464 afimoxifene results in decreased expression of TFAP2A mRNA CTD PMID:19901195 Tfap2a Rat aflatoxin B1 decreases methylation ISO TFAP2A (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TFAP2A gene CTD PMID:27153756 Tfap2a Rat all-trans-retinoic acid multiple interactions ISO TFAP2A (Homo sapiens) 6480464 Tretinoin inhibits the reaction [TFAP2A protein binds to DPYSL2 promoter] more ... CTD PMID:17229153 and PMID:17318229 Tfap2a Rat all-trans-retinoic acid increases expression ISO TFAP2A (Homo sapiens) 6480464 Tretinoin results in increased expression of TFAP2A mRNA CTD PMID:17138961 more ... Tfap2a Rat all-trans-retinoic acid affects localization ISO TFAP2A (Homo sapiens) 6480464 Tretinoin affects the localization of TFAP2A protein CTD PMID:17229153 Tfap2a Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TFAP2A mRNA CTD PMID:35163327 Tfap2a Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TFAP2A mRNA CTD PMID:30047161 Tfap2a Rat antimycin A decreases expression ISO TFAP2A (Homo sapiens) 6480464 Antimycin A results in decreased expression of TFAP2A mRNA CTD PMID:33512557 Tfap2a Rat antirheumatic drug decreases expression ISO TFAP2A (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TFAP2A mRNA CTD PMID:24449571 Tfap2a Rat Arg-Gly-Asp decreases expression ISO TFAP2A (Homo sapiens) 6480464 arginyl-glycyl-aspartic acid results in decreased expression of TFAP2A protein CTD PMID:37027338 Tfap2a Rat arotinoid acid multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Tfap2a Rat arsenite(3-) decreases methylation ISO TFAP2A (Homo sapiens) 6480464 arsenite results in decreased methylation of TFAP2A promoter CTD PMID:23974009 Tfap2a Rat belinostat increases expression ISO TFAP2A (Homo sapiens) 6480464 belinostat results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat belinostat multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat benzo[a]pyrene decreases expression ISO Tfap2a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TFAP2A mRNA CTD PMID:22228805 Tfap2a Rat benzo[a]pyrene increases expression ISO TFAP2A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TFAP2A mRNA CTD PMID:32234424 Tfap2a Rat benzo[a]pyrene decreases methylation ISO TFAP2A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TFAP2A 3' UTR more ... CTD PMID:27901495 Tfap2a Rat benzo[a]pyrene diol epoxide I increases expression ISO TFAP2A (Homo sapiens) 6480464 7 more ... CTD PMID:17944540 Tfap2a Rat benzo[a]pyrene diol epoxide I decreases expression ISO TFAP2A (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Tfap2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TFAP2A mRNA CTD PMID:25181051 Tfap2a Rat bisphenol A multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TFAP2A gene CTD PMID:31601247 Tfap2a Rat bisphenol A affects methylation ISO Tfap2a (Mus musculus) 6480464 bisphenol A affects the methylation of TFAP2A promoter CTD PMID:27334623 Tfap2a Rat Bisphenol A diglycidyl ether multiple interactions ISO Tfap2a (Mus musculus) 6480464 bisphenol A diglycidyl ether inhibits the reaction [Cytarabine results in increased expression of TFAP2A mRNA] CTD PMID:23264188 Tfap2a Rat bisphenol F decreases expression ISO Tfap2a (Mus musculus) 6480464 bisphenol F results in decreased expression of TFAP2A mRNA CTD PMID:30951980 Tfap2a Rat butan-1-ol multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of TFAP2A mRNA CTD PMID:29432896 Tfap2a Rat butanal decreases expression ISO TFAP2A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of TFAP2A mRNA CTD PMID:26079696 Tfap2a Rat Butylbenzyl phthalate affects localization ISO TFAP2A (Homo sapiens) 6480464 butylbenzyl phthalate affects the localization of TFAP2A protein CTD PMID:22552774 Tfap2a Rat Butylbenzyl phthalate multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [butylbenzyl phthalate promotes the reaction [TFAP2A protein binds to HDAC6 promoter]] which results in increased expression of HDAC6 mRNA more ... CTD PMID:22552774 Tfap2a Rat cadmium atom decreases activity ISO Tfap2a (Mus musculus) 6480464 Cadmium results in decreased activity of TFAP2A protein CTD PMID:33642518 Tfap2a Rat calcitriol increases expression ISO TFAP2A (Homo sapiens) 6480464 Calcitriol results in increased expression of TFAP2A mRNA CTD PMID:26485663 Tfap2a Rat cannabidiol multiple interactions ISO Tfap2a (Mus musculus) 6480464 T 0070907 inhibits the reaction [Cannabidiol analog results in increased expression of TFAP2A mRNA] CTD PMID:30382123 Tfap2a Rat cannabidiol increases expression ISO Tfap2a (Mus musculus) 6480464 Cannabidiol analog results in increased expression of TFAP2A mRNA CTD PMID:30382123 Tfap2a Rat carboplatin increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Carboplatin CTD PMID:16204029 Tfap2a Rat CHIR 99021 multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Tfap2a Rat chlorpyrifos decreases expression ISO Tfap2a (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TFAP2A mRNA CTD PMID:32715474 Tfap2a Rat chlorpyrifos increases expression ISO Tfap2a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TFAP2A mRNA CTD PMID:37019170 Tfap2a Rat choline multiple interactions ISO Tfap2a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of TFAP2A gene CTD PMID:20938992 Tfap2a Rat cidofovir anhydrous decreases expression ISO TFAP2A (Homo sapiens) 6480464 Cidofovir results in decreased expression of TFAP2A mRNA CTD PMID:25596134 Tfap2a Rat cisplatin increases expression ISO TFAP2A (Homo sapiens) 6480464 Cisplatin results in increased expression of TFAP2A protein CTD PMID:16204029 Tfap2a Rat cisplatin decreases expression ISO TFAP2A (Homo sapiens) 6480464 Cisplatin results in decreased expression of TFAP2A mRNA CTD PMID:25596134 Tfap2a Rat cisplatin increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Cisplatin CTD PMID:16204029 and PMID:21489314 Tfap2a Rat cisplatin affects response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein affects the susceptibility to Cisplatin CTD PMID:16217747 Tfap2a Rat cisplatin multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [decitabine results in increased expression of TFAP2A protein] which results in increased susceptibility to Cisplatin and [TFAP2A protein co-treated with TP53 gene mutant form] results in decreased susceptibility to Cisplatin CTD PMID:16204029 and PMID:21489314 Tfap2a Rat clodronic acid decreases expression ISO TFAP2A (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of TFAP2A mRNA CTD PMID:25596134 Tfap2a Rat clomiphene increases expression ISO TFAP2A (Homo sapiens) 6480464 Clomiphene results in increased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat cortisol multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Tfap2a Rat coumarin increases phosphorylation ISO TFAP2A (Homo sapiens) 6480464 coumarin results in increased phosphorylation of TFAP2A protein CTD PMID:35688186 Tfap2a Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TFAP2A mRNA CTD PMID:27523638 Tfap2a Rat cycloheximide decreases stability ISO TFAP2A (Homo sapiens) 6480464 Cycloheximide results in decreased stability of TFAP2A protein CTD PMID:36576707 Tfap2a Rat cycloheximide multiple interactions ISO TFAP2A (Homo sapiens) 6480464 LINC-ROR promotes the reaction [Cycloheximide results in decreased stability of TFAP2A protein] CTD PMID:36576707 Tfap2a Rat cyclosporin A decreases expression ISO TFAP2A (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TFAP2A mRNA CTD PMID:25596134 Tfap2a Rat cytarabine increases expression ISO Tfap2a (Mus musculus) 6480464 Cytarabine results in increased expression of TFAP2A mRNA CTD PMID:23264188 Tfap2a Rat cytarabine multiple interactions ISO Tfap2a (Mus musculus) 6480464 bisphenol A diglycidyl ether inhibits the reaction [Cytarabine results in increased expression of TFAP2A mRNA] CTD PMID:23264188 Tfap2a Rat decabromodiphenyl ether increases expression ISO TFAP2A (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of TFAP2A mRNA CTD PMID:31326446 Tfap2a Rat dexamethasone multiple interactions ISO Tfap2a (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of TFAP2A mRNA and Acrylamide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of TFAP2A mRNA] CTD PMID:30409764 Tfap2a Rat dibutyl phthalate multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [Dibutyl Phthalate promotes the reaction [TFAP2A protein binds to HDAC6 promoter]] which results in increased expression of HDAC6 mRNA more ... CTD PMID:22552774 Tfap2a Rat dibutyl phthalate affects localization ISO TFAP2A (Homo sapiens) 6480464 Dibutyl Phthalate affects the localization of TFAP2A protein CTD PMID:22552774 Tfap2a Rat diethylstilbestrol decreases expression ISO TFAP2A (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat dorsomorphin multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tfap2a Rat doxorubicin multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [decitabine results in increased expression of TFAP2A protein] which results in increased susceptibility to Doxorubicin CTD PMID:16204029 Tfap2a Rat doxorubicin increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Doxorubicin CTD PMID:16204029 Tfap2a Rat doxorubicin increases expression ISO TFAP2A (Homo sapiens) 6480464 Doxorubicin results in increased expression of TFAP2A protein CTD PMID:16204029 Tfap2a Rat entinostat increases expression ISO TFAP2A (Homo sapiens) 6480464 entinostat results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat entinostat multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat erlotinib hydrochloride multiple interactions ISO TFAP2A (Homo sapiens) 6480464 Erlotinib Hydrochloride inhibits the reaction [TFAP2A protein binds to ULBP1 promoter] and Tetradecanoylphorbol Acetate inhibits the reaction [Erlotinib Hydrochloride inhibits the reaction [TFAP2A protein binds to ULBP1 promoter]] CTD PMID:21499124 and PMID:21951556 Tfap2a Rat ethanol increases expression ISO TFAP2A (Homo sapiens) 6480464 Ethanol results in increased expression of TFAP2A mRNA CTD PMID:28986285 Tfap2a Rat etoposide affects response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein affects the susceptibility to Etoposide CTD PMID:16217747 Tfap2a Rat etoposide increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Etoposide CTD PMID:16204029 Tfap2a Rat fenpropidin increases expression ISO Tfap2a (Mus musculus) 6480464 fenpropidine results in increased expression of TFAP2A protein CTD PMID:34737147 Tfap2a Rat flusilazole increases expression ISO Tfap2a (Mus musculus) 6480464 flusilazole results in increased expression of TFAP2A mRNA and flusilazole results in increased expression of TFAP2A protein CTD PMID:34737147 Tfap2a Rat folic acid multiple interactions ISO Tfap2a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of TFAP2A gene CTD PMID:20938992 Tfap2a Rat fulvestrant increases expression ISO TFAP2A (Homo sapiens) 6480464 fulvestrant results in increased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat fulvestrant multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TFAP2A gene CTD PMID:31601247 Tfap2a Rat furan increases expression EXP 6480464 furan results in increased expression of TFAP2A mRNA CTD PMID:25539665 Tfap2a Rat gefitinib multiple interactions ISO TFAP2A (Homo sapiens) 6480464 gefitinib inhibits the reaction [TFAP2A protein binds to ULBP1 promoter] and Tetradecanoylphorbol Acetate inhibits the reaction [gefitinib inhibits the reaction [TFAP2A protein binds to ULBP1 promoter]] CTD PMID:21499124 and PMID:21951556 Tfap2a Rat gemcitabine increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Gemcitabine CTD PMID:21489314 Tfap2a Rat gemcitabine multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [TFAP2A protein co-treated with TP53 gene mutant form] results in decreased susceptibility to Gemcitabine CTD PMID:21489314 Tfap2a Rat genistein decreases expression ISO TFAP2A (Homo sapiens) 6480464 Genistein results in decreased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TFAP2A mRNA CTD PMID:33387578 Tfap2a Rat geraniol increases expression ISO TFAP2A (Homo sapiens) 6480464 geraniol results in increased expression of TFAP2A mRNA CTD PMID:27683099 Tfap2a Rat glycidyl methacrylate increases expression ISO TFAP2A (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of TFAP2A protein CTD PMID:36641056 Tfap2a Rat glyphosate decreases expression ISO Tfap2a (Mus musculus) 6480464 Glyphosate results in decreased expression of TFAP2A mRNA CTD PMID:33713393 Tfap2a Rat hexestrol decreases expression ISO TFAP2A (Homo sapiens) 6480464 Hexestrol results in decreased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat ifosfamide decreases expression ISO TFAP2A (Homo sapiens) 6480464 Ifosfamide results in decreased expression of TFAP2A mRNA CTD PMID:25596134 Tfap2a Rat imidacloprid multiple interactions ISO Tfap2a (Mus musculus) 6480464 [imidacloprid co-treated with Dietary Fats] results in decreased expression of TFAP2A mRNA CTD PMID:33487623 Tfap2a Rat indinavir decreases expression ISO Tfap2a (Mus musculus) 6480464 Indinavir results in decreased expression of TFAP2A mRNA CTD PMID:17926646 Tfap2a Rat kahweol decreases expression ISO TFAP2A (Homo sapiens) 6480464 kahweol results in decreased expression of TFAP2A mRNA and kahweol results in decreased expression of TFAP2A protein CTD PMID:30205135 Tfap2a Rat L-ascorbic acid multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of TFAP2A mRNA CTD PMID:34480604 Tfap2a Rat L-ascorbic acid 2-phosphate multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of TFAP2A mRNA CTD PMID:34480604 Tfap2a Rat L-methionine multiple interactions ISO Tfap2a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of TFAP2A gene CTD PMID:20938992 Tfap2a Rat lipopolysaccharide increases expression ISO TFAP2A (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TFAP2A mRNA CTD PMID:35811015 Tfap2a Rat lipopolysaccharide multiple interactions ISO TFAP2A (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of TFAP2A mRNA] CTD PMID:35811015 Tfap2a Rat manganese atom increases expression EXP 6480464 Manganese results in increased expression of TFAP2A protein CTD PMID:24845367 Tfap2a Rat manganese(0) increases expression EXP 6480464 Manganese results in increased expression of TFAP2A protein CTD PMID:24845367 Tfap2a Rat mercury dibromide increases expression ISO TFAP2A (Homo sapiens) 6480464 mercuric bromide results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat mercury dibromide multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat mestranol decreases expression ISO TFAP2A (Homo sapiens) 6480464 Mestranol results in decreased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of TFAP2A mRNA CTD PMID:28341135 Tfap2a Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of TFAP2A mRNA CTD PMID:30047161 Tfap2a Rat methotrexate affects expression ISO Tfap2a (Mus musculus) 6480464 Methotrexate affects the expression of TFAP2A mRNA CTD PMID:18502557 Tfap2a Rat methylmercury chloride increases expression ISO TFAP2A (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TFAP2A mRNA CTD PMID:23179753 and PMID:26272509 Tfap2a Rat methylmercury chloride decreases expression ISO TFAP2A (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TFAP2A mRNA CTD PMID:28001369 Tfap2a Rat methylparaben decreases expression ISO TFAP2A (Homo sapiens) 6480464 methylparaben results in decreased expression of TFAP2A mRNA CTD PMID:31745603 Tfap2a Rat mitomycin C affects response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein affects the susceptibility to Mitomycin CTD PMID:16217747 Tfap2a Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO TFAP2A (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [butylbenzyl phthalate affects the localization of TFAP2A protein] and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Dibutyl Phthalate affects the localization of TFAP2A protein] CTD PMID:22552774 Tfap2a Rat nickel subsulfide decreases expression ISO TFAP2A (Homo sapiens) 6480464 nickel subsulfide results in decreased expression of TFAP2A mRNA CTD PMID:12760830 Tfap2a Rat Octicizer decreases expression ISO TFAP2A (Homo sapiens) 6480464 2-ethylhexyldiphenylphosphate results in decreased expression of TFAP2A protein CTD PMID:37027338 Tfap2a Rat ozone multiple interactions ISO TFAP2A (Homo sapiens) 6480464 Ozone promotes the reaction [TFAP2A protein binds to BRS3 promoter] and TFAP2A protein affects the reaction [Ozone results in increased expression of BRS3 mRNA] CTD PMID:17355223 Tfap2a Rat ozone multiple interactions ISO Tfap2a (Mus musculus) 6480464 Ozone promotes the reaction [[TFAP2A protein binds to CTNNAL1 protein] which results in increased expression of CTNNAL1 mRNA] CTD PMID:22359570 Tfap2a Rat ozone increases activity ISO TFAP2A (Homo sapiens) 6480464 Ozone results in increased activity of TFAP2A protein CTD PMID:17355223 Tfap2a Rat p-chloromercuribenzoic acid increases expression ISO TFAP2A (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat p-chloromercuribenzoic acid multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat paclitaxel increases response to substance ISO TFAP2A (Homo sapiens) 6480464 TFAP2A protein results in increased susceptibility to Paclitaxel CTD PMID:16204029 Tfap2a Rat paclitaxel increases expression ISO TFAP2A (Homo sapiens) 6480464 Paclitaxel results in increased expression of TFAP2A protein CTD PMID:16204029 Tfap2a Rat panobinostat multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat panobinostat increases expression ISO TFAP2A (Homo sapiens) 6480464 panobinostat results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat paracetamol decreases expression ISO TFAP2A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TFAP2A mRNA CTD PMID:26690555 Tfap2a Rat paracetamol increases expression ISO TFAP2A (Homo sapiens) 6480464 Acetaminophen results in increased expression of TFAP2A mRNA CTD PMID:29067470 Tfap2a Rat paraquat increases expression ISO TFAP2A (Homo sapiens) 6480464 Paraquat results in increased expression of TFAP2A mRNA CTD PMID:35182771 Tfap2a Rat paroxetine increases expression ISO TFAP2A (Homo sapiens) 6480464 Paroxetine results in increased expression of TFAP2A protein CTD PMID:28844482 Tfap2a Rat perfluorohexanesulfonic acid decreases expression ISO Tfap2a (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of TFAP2A mRNA CTD PMID:37995155 Tfap2a Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TFAP2A mRNA CTD PMID:35163327 Tfap2a Rat phenylmercury acetate increases expression ISO TFAP2A (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat phenylmercury acetate multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat phorbol 13-acetate 12-myristate multiple interactions ISO TFAP2A (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [Erlotinib Hydrochloride inhibits the reaction [TFAP2A protein binds to ULBP1 promoter]] and Tetradecanoylphorbol Acetate inhibits the reaction [gefitinib inhibits the reaction [TFAP2A protein binds to ULBP1 promoter]] CTD PMID:21499124 and PMID:21951556 Tfap2a Rat picoxystrobin decreases expression ISO TFAP2A (Homo sapiens) 6480464 picoxystrobin results in decreased expression of TFAP2A mRNA CTD PMID:33512557 Tfap2a Rat pirinixic acid increases expression ISO Tfap2a (Mus musculus) 6480464 pirinixic acid results in increased expression of TFAP2A mRNA CTD PMID:18445702 Tfap2a Rat raloxifene increases expression ISO TFAP2A (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of TFAP2A mRNA CTD PMID:26865669 Tfap2a Rat raloxifene multiple interactions ISO Tfap2a (Mus musculus) 6480464 [Streptozocin co-treated with Raloxifene Hydrochloride] results in increased expression of TFAP2A protein CTD PMID:23471663 Tfap2a Rat resveratrol multiple interactions ISO TFAP2A (Homo sapiens) 6480464 resveratrol results in increased localization of and results in increased activity of TFAP2A protein CTD PMID:16488535 Tfap2a Rat rotenone decreases expression ISO TFAP2A (Homo sapiens) 6480464 Rotenone results in decreased expression of TFAP2A mRNA CTD PMID:33512557 Tfap2a Rat rottlerin multiple interactions ISO TFAP2A (Homo sapiens) 6480464 rottlerin inhibits the reaction [TFAP2A protein binds to ULBP1 promoter] CTD PMID:21499124 Tfap2a Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TFAP2A (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of TFAP2A mRNA] CTD PMID:35811015 Tfap2a Rat SB 431542 multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:34480604 Tfap2a Rat sertraline increases expression ISO TFAP2A (Homo sapiens) 6480464 Sertraline results in increased expression of TFAP2A protein CTD PMID:28844482 Tfap2a Rat sodium arsenite decreases expression ISO TFAP2A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TFAP2A mRNA CTD PMID:38568856 Tfap2a Rat spiroxamine increases expression ISO Tfap2a (Mus musculus) 6480464 spiroxamine results in increased expression of TFAP2A protein CTD PMID:34737147 Tfap2a Rat stavudine decreases expression ISO Tfap2a (Mus musculus) 6480464 Stavudine results in decreased expression of TFAP2A mRNA CTD PMID:17926646 Tfap2a Rat streptozocin multiple interactions EXP 6480464 MFN2 protein mutant form inhibits the reaction [Streptozocin promotes the reaction [TFAP2A protein binds to COL4A1 promoter]] and Streptozocin promotes the reaction [TFAP2A protein binds to COL4A1 promoter] CTD PMID:27997345 Tfap2a Rat streptozocin multiple interactions ISO Tfap2a (Mus musculus) 6480464 [Streptozocin co-treated with Raloxifene Hydrochloride] results in increased expression of TFAP2A protein CTD PMID:23471663 Tfap2a Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of TFAP2A mRNA CTD PMID:30047161 Tfap2a Rat temozolomide increases expression ISO TFAP2A (Homo sapiens) 6480464 Temozolomide results in increased expression of TFAP2A mRNA CTD PMID:31758290 Tfap2a Rat testosterone decreases expression ISO TFAP2A (Homo sapiens) 6480464 Testosterone results in decreased expression of TFAP2A mRNA CTD PMID:33359661 Tfap2a Rat Tetrachlorobisphenol A increases expression ISO TFAP2A (Homo sapiens) 6480464 tetrachlorodian results in increased expression of TFAP2A mRNA CTD PMID:31326446 Tfap2a Rat titanium dioxide decreases methylation ISO Tfap2a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TFAP2A gene and titanium dioxide results in decreased methylation of TFAP2A promoter CTD PMID:35295148 Tfap2a Rat titanium dioxide increases methylation ISO Tfap2a (Mus musculus) 6480464 titanium dioxide results in increased methylation of TFAP2A gene and titanium dioxide results in increased methylation of TFAP2A promoter CTD PMID:35295148 Tfap2a Rat trichloroethene increases expression ISO Tfap2a (Mus musculus) 6480464 Trichloroethylene results in increased expression of TFAP2A mRNA CTD PMID:21135412 Tfap2a Rat trichostatin A increases expression ISO TFAP2A (Homo sapiens) 6480464 trichostatin A results in increased expression of TFAP2A mRNA CTD PMID:24935251 and PMID:26272509 Tfap2a Rat trichostatin A multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat triclosan decreases expression ISO TFAP2A (Homo sapiens) 6480464 Triclosan results in decreased expression of TFAP2A mRNA CTD PMID:30510588 Tfap2a Rat troglitazone decreases expression ISO TFAP2A (Homo sapiens) 6480464 Troglitazone results in decreased expression of TFAP2A mRNA and Troglitazone results in decreased expression of TFAP2A protein CTD PMID:32822399 Tfap2a Rat troglitazone multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [Troglitazone co-treated with 4-((3-bromophenyl)amino)-6 more ... CTD PMID:32822399 Tfap2a Rat tyrphostin AG 1478 multiple interactions ISO TFAP2A (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [butylbenzyl phthalate affects the localization of TFAP2A protein] and RTKI cpd inhibits the reaction [Dibutyl Phthalate affects the localization of TFAP2A protein] CTD PMID:22552774 Tfap2a Rat valproic acid affects expression ISO Tfap2a (Mus musculus) 6480464 Valproic Acid affects the expression of TFAP2A mRNA CTD PMID:17292431 Tfap2a Rat valproic acid decreases expression ISO Tfap2a (Mus musculus) 6480464 Valproic Acid results in decreased expression of TFAP2A mRNA CTD PMID:31445079 Tfap2a Rat valproic acid decreases expression ISO TFAP2A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TFAP2A mRNA CTD PMID:28001369 Tfap2a Rat valproic acid multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:32623605 Tfap2a Rat valproic acid increases expression ISO TFAP2A (Homo sapiens) 6480464 Valproic Acid results in increased expression of TFAP2A mRNA CTD PMID:23179753 more ... Tfap2a Rat valproic acid decreases methylation ISO TFAP2A (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TFAP2A gene CTD PMID:29154799 Tfap2a Rat valproic acid affects expression ISO TFAP2A (Homo sapiens) 6480464 Valproic Acid affects the expression of TFAP2A mRNA CTD PMID:25979313 Tfap2a Rat vincristine decreases expression ISO TFAP2A (Homo sapiens) 6480464 Vincristine results in decreased expression of TFAP2A mRNA CTD PMID:23649840 Tfap2a Rat vorinostat multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFAP2A mRNA CTD PMID:27188386 Tfap2a Rat vorinostat increases expression ISO TFAP2A (Homo sapiens) 6480464 vorinostat results in increased expression of TFAP2A mRNA CTD PMID:26272509 Tfap2a Rat XAV939 multiple interactions ISO TFAP2A (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of TFAP2A mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of TFAP2A mRNA CTD PMID:34480604 Tfap2a Rat zidovudine decreases expression ISO Tfap2a (Mus musculus) 6480464 Zidovudine results in decreased expression of TFAP2A mRNA CTD PMID:17926646
(-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) antimycin A (ISO) antirheumatic drug (ISO) Arg-Gly-Asp (ISO) arotinoid acid (ISO) arsenite(3-) (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol F (ISO) butan-1-ol (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) calcitriol (ISO) cannabidiol (ISO) carboplatin (ISO) CHIR 99021 (ISO) chlorpyrifos (ISO) choline (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) clomiphene (ISO) cortisol (ISO) coumarin (ISO) Cuprizon (EXP) cycloheximide (ISO) cyclosporin A (ISO) cytarabine (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) erlotinib hydrochloride (ISO) ethanol (ISO) etoposide (ISO) fenpropidin (ISO) flusilazole (ISO) folic acid (ISO) fulvestrant (ISO) furan (EXP) gefitinib (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) geraniol (ISO) glycidyl methacrylate (ISO) glyphosate (ISO) hexestrol (ISO) ifosfamide (ISO) imidacloprid (ISO) indinavir (ISO) kahweol (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) L-methionine (ISO) lipopolysaccharide (ISO) manganese atom (EXP) manganese(0) (EXP) mercury dibromide (ISO) mestranol (ISO) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) methylparaben (ISO) mitomycin C (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) nickel subsulfide (ISO) Octicizer (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) paroxetine (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (ISO) rottlerin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sertraline (ISO) sodium arsenite (ISO) spiroxamine (ISO) stavudine (ISO) streptozocin (EXP,ISO) sulfadimethoxine (EXP) temozolomide (ISO) testosterone (ISO) Tetrachlorobisphenol A (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) troglitazone (ISO) tyrphostin AG 1478 (ISO) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) XAV939 (ISO) zidovudine (ISO)
Biological Process
anterior neuropore closure (ISO) basement membrane organization (ISO) bone morphogenesis (ISO,ISS) cell population proliferation (ISO) cellular response to iron ion (ISO,ISS) cornea development in camera-type eye (ISO) embryonic body morphogenesis (ISO) embryonic camera-type eye morphogenesis (ISO) embryonic cranial skeleton morphogenesis (ISO,ISS) embryonic forelimb morphogenesis (ISO,ISS) embryonic pattern specification (ISO) epidermal growth factor receptor signaling pathway (ISO) epidermis morphogenesis (ISO) eyelid development in camera-type eye (ISO,ISS) face morphogenesis (ISO) fibroblast migration (ISO) forebrain neuron development (ISO) forelimb morphogenesis (ISO) inner ear morphogenesis (ISO,ISS) keratinocyte development (ISO) kidney development (IBA,ISO,ISS) lens induction in camera-type eye (ISO) lens morphogenesis in camera-type eye (ISO) metanephric nephron development (ISO) negative regulation of apoptotic process (IBA,ISO,ISS) negative regulation of cell population proliferation (ISO) negative regulation of DNA-templated transcription (ISO) negative regulation of epidermal growth factor receptor signaling pathway (ISO) negative regulation of neuron apoptotic process (ISO) negative regulation of reactive oxygen species metabolic process (ISO,ISS) negative regulation of transcription by competitive promoter binding (ISO,ISS) negative regulation of transcription by RNA polymerase II (ISO,ISS) nervous system development (IBA,ISO) neural crest cell development (ISO) neural tube closure (ISO) neuron apoptotic process (ISO) oculomotor nerve formation (ISO,ISS) optic cup structural organization (ISO,ISS) optic vesicle morphogenesis (ISO,ISS) outflow tract morphogenesis (ISO) positive regulation of bone mineralization (ISO,ISS) positive regulation of DNA-templated transcription (ISO,ISS) positive regulation of fibroblast migration (ISO) positive regulation of gene expression (ISO,ISS) positive regulation of neuron apoptotic process (ISO) positive regulation of tooth mineralization (ISO,ISS) positive regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO,ISS) regulation of cell differentiation (ISO) regulation of cell population proliferation (IBA) regulation of DNA-templated transcription (IEA,ISO) regulation of neuron differentiation (ISO) regulation of transcription by RNA polymerase II (ISO) response to lipopolysaccharide (IDA) retina layer formation (ISO) roof of mouth development (ISO,ISS) Schwann cell development (IEP) sensory organ development (ISO) sensory perception of sound (ISO,ISS) skeletal system development (IBA) skeletal system morphogenesis (ISO) skin development (ISO) sympathetic nervous system development (ISO) transcription by RNA polymerase II (ISO) trigeminal nerve development (ISO,ISS)
Molecular Function
chromatin binding (ISO,ISS) cis-regulatory region sequence-specific DNA binding (ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IBA,ISO,ISS) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (ISO,ISS) DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO,ISS) identical protein binding (ISO) protein binding (IPI,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO,ISS) RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,ISO) sequence-specific DNA binding (IDA,ISO) sequence-specific double-stranded DNA binding (ISO) transcription cis-regulatory region binding (ISO,ISS) transcription coactivator activity (ISO) transcription corepressor activity (ISO) transcription factor binding (IPI)
1.
Physical and functional interactions among AP-2 transcription factors, p300/CREB-binding protein, and CITED2.
Braganca J, etal., J Biol Chem. 2003 May 2;278(18):16021-9. Epub 2003 Feb 12.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Effect of cysteamine on redox-sensitive thiol-containing proteins in the duodenal mucosa.
Khomenko T, etal., Biochem Biophys Res Commun. 2003 Oct 3;309(4):910-6.
5.
Tumor suppressor activity of AP2alpha mediated through a direct interaction with p53.
McPherson LA, etal., J Biol Chem. 2002 Nov 22;277(47):45028-33. Epub 2002 Sep 10.
6.
Sustained increases in activating transcription factor-2 and activator protein-2 in the rat supraoptic nucleus during water deprivation.
Meeker RB and Fernandes A, Neuroendocrinology. 2002 Aug;76(2):111-20.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Transcription factor AP-2alpha triggers apoptosis in cardiac myocytes.
Muller FU, etal., Cell Death Differ. 2004 May;11(5):485-93.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Chronic administration of carbamazepine down-regulates AP-2 DNA-binding activity and AP-2alpha protein expression in rat frontal cortex.
Rao JS, etal., Biol Psychiatry. 2007 Jan 15;61(2):154-61. Epub 2006 Jun 27.
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
The NECAP PHear domain increases clathrin accessory protein binding potential.
Ritter B, etal., EMBO J. 2007 Sep 19;26(18):4066-77. Epub 2007 Aug 30.
15.
Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
16.
Developmental regulation and overexpression of the transcription factor AP-2, a potential regulator of the timing of Schwann cell generation.
Stewart HJ, etal., Eur J Neurosci. 2001 Jul;14(2):363-72.
17.
PACAP-regulated phenylethanolamine N-methyltransferase gene expression.
Tai TC, etal., J Neurochem. 2010 Dec;115(5):1195-205. doi: 10.1111/j.1471-4159.2010.07005.x. Epub 2010 Oct 12.
18.
Lipopolysaccharide regulates constitutive and inducible transcription factor activities differentially in vivo in the rat.
Ye X and Liu SF, Biochem Biophys Res Commun. 2001 Nov 9;288(4):927-32.
Tfap2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 24,230,064 - 24,253,219 (+) NCBI GRCr8 mRatBN7.2 17 24,028,716 - 24,047,507 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 24,024,432 - 24,047,507 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 23,913,439 - 23,929,006 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 25,516,916 - 25,532,497 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 23,854,421 - 23,869,994 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 24,653,342 - 24,670,457 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 24,654,902 - 24,670,457 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 26,596,839 - 26,634,214 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 30,017,580 - 30,034,852 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 30,020,346 - 30,035,192 (+) NCBI Celera 17 23,700,225 - 23,715,767 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
TFAP2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 10,396,677 - 10,419,659 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 10,393,186 - 10,419,659 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 10,396,910 - 10,419,892 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 10,504,902 - 10,527,783 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 10,506,384 - 10,523,252 NCBI Celera 6 11,625,394 - 11,648,276 (-) NCBI Celera Cytogenetic Map 6 p24.3 NCBI HuRef 6 10,272,671 - 10,295,552 (-) NCBI HuRef CHM1_1 6 10,399,160 - 10,422,046 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 10,264,407 - 10,287,386 (-) NCBI T2T-CHM13v2.0
Tfap2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 40,867,278 - 40,891,715 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 40,868,778 - 40,891,852 (-) Ensembl GRCm39 Ensembl GRCm38 13 40,713,802 - 40,738,238 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 40,715,302 - 40,738,376 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 40,811,044 - 40,829,192 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 40,727,706 - 40,745,894 (-) NCBI MGSCv36 mm8 Celera 13 41,797,334 - 41,815,714 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 20.01 NCBI
Tfap2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 3,882,549 - 3,898,929 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 3,877,896 - 3,900,259 (+) NCBI ChiLan1.0 ChiLan1.0
TFAP2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 25,046,932 - 25,064,748 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 21,036,711 - 21,053,926 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 10,237,834 - 10,260,843 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 10,519,625 - 10,541,898 (-) NCBI panpan1.1 PanPan1.1 panPan2
TFAP2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 10,157,043 - 10,180,484 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 10,157,882 - 10,180,270 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 10,170,458 - 10,197,631 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 10,260,835 - 10,284,005 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 10,261,674 - 10,283,869 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 10,091,163 - 10,114,276 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 10,131,471 - 10,154,557 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 11,458,363 - 11,481,509 (-) NCBI UU_Cfam_GSD_1.0
Tfap2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 14,212,794 - 14,243,177 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 2,481,806 - 2,499,317 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 2,481,804 - 2,518,573 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TFAP2A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 7,221,656 - 7,244,612 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 7,221,654 - 7,244,626 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 7,534,956 - 7,556,586 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TFAP2A
Tfap2a
.
Predicted Target Of
Count of predictions: 359 Count of miRNA genes: 194 Interacting mature miRNAs: 221 Transcripts: ENSRNOT00000041960 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
TFAP2A
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 24,031,723 - 24,032,003 (+) MAPPER mRatBN7.2 Rnor_6.0 17 24,654,659 - 24,654,938 NCBI Rnor6.0 Rnor_5.0 17 26,596,596 - 26,596,875 UniSTS Rnor5.0 RGSC_v3.4 17 30,017,337 - 30,017,616 UniSTS RGSC3.4 Celera 17 23,699,982 - 23,700,261 UniSTS Cytogenetic Map 17 p12 UniSTS
AI013304
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 24,252,242 - 24,252,359 (+) Marker Load Pipeline mRatBN7.2 17 24,046,528 - 24,046,645 (+) MAPPER mRatBN7.2 Rnor_6.0 17 24,669,462 - 24,669,578 NCBI Rnor6.0 Rnor_5.0 17 26,611,399 - 26,611,515 UniSTS Rnor5.0 RGSC_v3.4 17 30,032,198 - 30,032,314 UniSTS RGSC3.4 Celera 17 23,714,785 - 23,714,901 UniSTS RH 3.4 Map 17 280.8 UniSTS Cytogenetic Map 17 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
35
101
34
36
16
8
16
6
124
55
89
45
54
20
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041960 ⟹ ENSRNOP00000040925
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,031,967 - 24,047,507 (+) Ensembl Rnor_6.0 Ensembl 17 24,654,902 - 24,670,457 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102035 ⟹ ENSRNOP00000078814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,024,432 - 24,047,507 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103008 ⟹ ENSRNOP00000082537
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,029,869 - 24,047,507 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105131 ⟹ ENSRNOP00000076636
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,029,746 - 24,047,507 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107954 ⟹ ENSRNOP00000088142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,030,646 - 24,047,507 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109680 ⟹ ENSRNOP00000081532
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,028,667 - 24,047,507 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110879 ⟹ ENSRNOP00000094618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 24,033,357 - 24,047,507 (+) Ensembl
RefSeq Acc Id:
NM_001107345 ⟹ NP_001100815
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 24,237,683 - 24,253,219 (+) NCBI mRatBN7.2 17 24,031,967 - 24,047,507 (+) NCBI Rnor_6.0 17 24,654,902 - 24,670,457 (+) NCBI Rnor_5.0 17 26,596,839 - 26,634,214 (+) NCBI RGSC_v3.4 17 30,017,580 - 30,034,852 (+) RGD Celera 17 23,700,225 - 23,715,767 (+) RGD
Sequence:
CCGATCCCGGGAGGATAGAGATCGTGGGTTCGACCAGTTGAAGGCGCCGCGCGACTCGGTGATACAAGTTCGGATGGATCCGAGCGGGGCTCCGACGCTCGCGGGAACGTCCGCGCGGTGACTGGAGT
hide sequence
RefSeq Acc Id:
XM_039095687 ⟹ XP_038951615
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 24,234,208 - 24,252,850 (+) NCBI mRatBN7.2 17 24,028,716 - 24,046,727 (+) NCBI
RefSeq Acc Id:
XM_063276385 ⟹ XP_063132455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 24,235,744 - 24,252,850 (+) NCBI
RefSeq Acc Id:
XM_063276386 ⟹ XP_063132456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 24,230,064 - 24,252,850 (+) NCBI
RefSeq Acc Id:
NP_001100815 ⟸ NM_001107345
- UniProtKB:
G3V9A8 (UniProtKB/TrEMBL), A6J784 (UniProtKB/TrEMBL), A0A8I6AMM5 (UniProtKB/TrEMBL)
- Sequence:
MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLL
hide sequence
Ensembl Acc Id:
ENSRNOP00000040925 ⟸ ENSRNOT00000041960
RefSeq Acc Id:
XP_038951615 ⟸ XM_039095687
- Peptide Label:
isoform X2
- UniProtKB:
P58197 (UniProtKB/Swiss-Prot), A0A8I5ZSF0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094618 ⟸ ENSRNOT00000110879
Ensembl Acc Id:
ENSRNOP00000081532 ⟸ ENSRNOT00000109680
Ensembl Acc Id:
ENSRNOP00000082537 ⟸ ENSRNOT00000103008
Ensembl Acc Id:
ENSRNOP00000088142 ⟸ ENSRNOT00000107954
Ensembl Acc Id:
ENSRNOP00000078814 ⟸ ENSRNOT00000102035
Ensembl Acc Id:
ENSRNOP00000076636 ⟸ ENSRNOT00000105131
RefSeq Acc Id:
XP_063132456 ⟸ XM_063276386
- Peptide Label:
isoform X3
- UniProtKB:
P58197 (UniProtKB/Swiss-Prot), A0A8I6G3W2 (UniProtKB/TrEMBL), A6J782 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063132455 ⟸ XM_063276385
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GGS6 (UniProtKB/TrEMBL), A0A8I6AMM5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-06-09
Tfap2a
transcription factor AP-2 alpha
Tcfap2a
transcription factor AP-2, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Tcfap2a
transcription factor AP-2, alpha
Tcfap2a_predicted
transcription factor AP-2, alpha (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Tcfap2a_predicted
transcription factor AP-2, alpha (predicted)
Symbol and Name status set to approved
70820 APPROVED
