Arsi (arylsulfatase family, member I)

Advanced Search (OLGA)

Gene: Arsi (arylsulfatase family, member I) Rattus norvegicus

Analyze

Symbol:

Arsi

Name:

arylsulfatase family, member I

RGD ID:

1310242

Description:

Predicted to enable metal ion binding activity and sulfuric ester hydrolase activity. Predicted to be located in endoplasmic reticulum and extracellular region. Orthologous to human ARSI (arylsulfatase family member I); INTERACTS WITH all-trans-retinoic acid; bisphenol A; furan.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arylsulfatase I; ASI; LOC307404; RGD1310242; similar to RIKEN cDNA 9330196J05

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARSI (arylsulfatase family member I)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Arsi (arylsulfatase i)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arsi (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARSI (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARSI (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arsi (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARSI (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arsi (arylsulfatase family member I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Arsi (arylsulfatase i)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ARSI (arylsulfatase family member I)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arsia (arylsulfatase family, member Ia)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arsib (arylsulfatase family, member Ib)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32191	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7402	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7408	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8646	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sul-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arsi	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	56,634,556 - 56,642,168 (+)	NCBI		GRCr8
mRatBN7.2	18	54,364,160 - 54,371,772 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	54,364,088 - 54,371,767 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	56,453,186 - 56,459,769 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,167,793 - 57,174,376 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	54,988,302 - 54,994,881 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,180,089 - 56,186,068 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,180,089 - 56,186,068 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	55,414,598 - 55,421,354 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	56,864,873 - 56,871,452 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	56,936,843 - 56,943,684 (+)	NCBI
Celera	18	52,518,894 - 52,525,437 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

familial adenomatous polyposis 1 (ISO)

Hereditary Neoplastic Syndromes (ISO)

hereditary spastic paraplegia (ISO)

paraplegia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

butanal (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

dicrotophos (ISO)

endosulfan (ISO)

entinostat (ISO)

furan (EXP)

leflunomide (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

potassium chromate (ISO)

propanal (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

endoplasmic reticulum (IEA)

extracellular region (IEA)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

sulfuric ester hydrolase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16174644

Genomics

Comparative Map Data

Arsi
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	56,634,556 - 56,642,168 (+)	NCBI		GRCr8
mRatBN7.2	18	54,364,160 - 54,371,772 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	54,364,088 - 54,371,767 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	56,453,186 - 56,459,769 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,167,793 - 57,174,376 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	54,988,302 - 54,994,881 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,180,089 - 56,186,068 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,180,089 - 56,186,068 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	55,414,598 - 55,421,354 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	56,864,873 - 56,871,452 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	56,936,843 - 56,943,684 (+)	NCBI
Celera	18	52,518,894 - 52,525,437 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

ARSI
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	150,296,343 - 150,302,905 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	150,296,343 - 150,339,307 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	149,675,906 - 149,682,468 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	149,656,970 - 149,662,129 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	145,757,304 - 145,763,920 (-)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	144,823,861 - 144,830,426 (-)	NCBI		HuRef
CHM1_1	5	149,108,498 - 149,115,114 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	150,832,882 - 150,839,444 (-)	NCBI		T2T-CHM13v2.0

Arsi
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	61,045,063 - 61,051,633 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	61,044,852 - 61,051,633 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	60,911,991 - 60,919,506 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	60,911,780 - 60,918,561 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	61,071,894 - 61,077,422 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	61,037,609 - 61,043,137 (+)	NCBI		MGSCv36	mm8
Celera	18	62,199,151 - 62,204,678 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	34.41	NCBI

Arsi
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	4,234,485 - 4,240,995 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	4,234,491 - 4,240,970 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARSI
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	145,524,965 - 145,532,229 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	143,664,513 - 143,671,782 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	145,720,651 - 145,763,532 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	151,725,650 - 151,732,271 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	151,725,264 - 151,732,277 (-)	Ensembl	panpan1.1		panPan2

ARSI
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	58,788,141 - 58,793,542 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	58,787,283 - 58,793,542 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	58,554,373 - 58,559,774 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	59,268,985 - 59,274,386 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	59,268,473 - 59,274,576 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	59,057,718 - 59,063,119 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	59,172,012 - 59,177,407 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	59,703,267 - 59,708,669 (+)	NCBI		UU_Cfam_GSD_1.0

Arsi
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	143,050,773 - 143,057,511 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	4,624,945 - 4,631,487 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	4,624,949 - 4,631,482 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARSI
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	52,905,950 - 52,913,404 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	52,906,825 - 52,911,986 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	24,804,188 - 24,811,099 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arsi
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	9,592,016 - 9,598,012 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	9,592,103 - 9,598,050 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arsi
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	51
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000030966
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	52292875	59796643	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	46988939	60377753	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	57867167	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	39	113	80	79	48	25	48	6	196	87	93	44	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BN000739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030966 ⟹ ENSRNOP00000033542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	54,364,088 - 54,371,767 (+)	Ensembl
Rnor_6.0 Ensembl	18	56,180,089 - 56,186,068 (+)	Ensembl

RefSeq Acc Id:

NM_001047881 ⟹ NP_001041346

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	56,634,556 - 56,642,168 (+)	NCBI
mRatBN7.2	18	54,364,160 - 54,371,772 (+)	NCBI
Rnor_6.0	18	56,180,089 - 56,186,068 (+)	NCBI
Rnor_5.0	18	55,414,598 - 55,421,354 (+)	NCBI
RGSC_v3.4	18	56,864,873 - 56,871,452 (+)	RGD
Celera	18	52,518,894 - 52,525,437 (+)	RGD

Sequence:

show sequence

ATGCATGCCCTCTCAGGATTCTCTCTTGTCAGCCTACTCAGTTTGGGCTACCTGTCCTGGGATT
GGGCCAAGCCCGGCCTTGTGGCTGATGGGCCTGCCGAGGCTGAGGATCAGCCTTCGGCGGCTCC
ACCGCAACCTCCACACATTATCTTCATTCTCACCGATGACCAAGGGTACCACGACGTGGGATAC
CATGGCTCAGATATTGAGACCCCAACGCTGGACCGGCTGGCAGCTGAGGGCGTCAAACTGGAGA
ATTATTACATCCAACCCATATGTACGCCTTCGAGGAGCCAACTCCTCACTGGCAGGTACCAGAT
CCATACAGGACTACAGCACTCCATCATCCGCCCACGGCAGCCCAACTGTCTGCCTCTGGACCAG
GTGACGCTGCCCCAGAAGCTACAGGAAGCAGGCTACTCCACCCACATGGTGGGCAAGTGGCATC
TGGGTTTCTACCGGAAGGAGTGCTTGCCTACCCGCAGGGGCTTTGACACCTTCCTGGGTTCCCT
CACAGGCAATGTGGACTATTACACCTATGACAACTGTGATGGCCCAGGGGTTTGTGGTTTTGAT
CTGCATGAGGGTGAGAGTGTGGCCTGGGGGCTCAGCGGCCAGTACTCCACTATGCTCTATGCTC
AGCGTGCAAGCCACATCCTGGCCAGCCACAGTCCCCAGAAGCCCCTCTTTCTCTATGTGGCCTT
CCAGGCAGTACACACACCCCTACAGTCACCTCGAGAGTACCTCTACCGCTACCGCACAATGGGC
AACGTAGCGAGGCGCAAGTACGCAGCCATGGTGACCTGCATGGATGAAGCTGTGCGCAACATCA
CCTGGGCTCTCAAGCGCTATGGTTTCTATAACAACAGTGTCATTATCTTCTCCAGTGACAACGG
TGGCCAAACCTTCTCAGGGGGTAGTAACTGGCCCCTTCGAGGACGAAAGGGTACTTATTGGGAA
GGAGGTGTGAGGGGGCTGGGTTTTGTCCACAGCCCACTGCTCAAGAAAAAAAGACGGACCAGTC
GGGCCTTGGTCCATATCACAGACTGGTACCCAACACTGGTGGGTCTGGCAGGTGGCACTACATC
CGCTGCTGATGGACTTGATGGCTATGACGTGTGGCCAGCCATTAGTGAGGGCCGGGCCTCACCA
CGCACAGAGATCCTACACAACATTGACCCCCTCTACAACCATGCCCGGCATGGCTCCTTGGAGG
GTGGCTTTGGCATCTGGAATACAGCAGTGCAGGCTGCTATCCGAGTCGGAGAGTGGAAGCTCCT
CACTGGAGACCCAGGTTATGGTGACTGGATTCCACCTCAGACACTGGCCTCCTTCCCTGGCAGT
TGGTGGAACCTAGAGCGGATGGCCAGCATCCGCCAGGCTGTGTGGCTCTTTAACATCAGTGCTG
ACCCTTATGAACGAGAGGACCTAGCTGACCAGCGACCTGATGTAGTCCGCACCCTGCTGGCTCG
CCTGGCTGATTATAACCGTACTGCCATCCCTGTGCGTTACCCAGCTGCGAACCCTCGGGCCCAT
CCTGACTTTAATGGGGGTGCTTGGGGACCCTGGGCCAGTGATGAGGATGAAGAAGAGGAGGATG
AAGAGGAGGAAGGCAGAGCTAGAAGTTTCCCCCGGGGTCGACGCAAGAAGAAATGCAAGATTTG
CAAGCTTCGATCTTTTTTCCGTAAACTCAATACCAGGCTGATGTCCCACCGGATCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001041346	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAI84985	(Get FASTA)	NCBI Sequence Viewer
	EDM14578	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000033542.4
	ENSRNOP00055021194
	ENSRNOP00060030770
	ENSRNOP00065032279
GenBank Protein	Q32KJ8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001041346 ⟸ NM_001047881
- Peptide Label:	precursor
- UniProtKB:	Q32KJ8 (UniProtKB/Swiss-Prot), A6IXE7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MHALSGFSLVSLLSLGYLSWDWAKPGLVADGPAEAEDQPSAAPPQPPHIIFILTDDQGYHDVGY HGSDIETPTLDRLAAEGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPRQPNCLPLDQ VTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFD LHEGESVAWGLSGQYSTMLYAQRASHILASHSPQKPLFLYVAFQAVHTPLQSPREYLYRYRTMG NVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWE GGVRGLGFVHSPLLKKKRRTSRALVHITDWYPTLVGLAGGTTSAADGLDGYDVWPAISEGRASP RTEILHNIDPLYNHARHGSLEGGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLASFPGS WWNLERMASIRQAVWLFNISADPYEREDLADQRPDVVRTLLARLADYNRTAIPVRYPAANPRAH PDFNGGAWGPWASDEDEEEEDEEEEGRARSFPRGRRKKKCKICKLRSFFRKLNTRLMSHRI hide sequence

Ensembl Acc Id:

ENSRNOP00000033542 ⟸ ENSRNOT00000030966

Protein Domains

Sulfatase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32KJ8-F1-model_v2	AlphaFold	Q32KJ8	1-573	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700809

Promoter ID:

EPDNEW_R11333

Type:

single initiation site

Name:

Arsi_1

Description:

arylsulfatase family, member I

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	56,180,031 - 56,180,091	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310242	AgrOrtholog
BioCyc Gene	G2FUF-7352	BioCyc
Ensembl Genes	ENSRNOG00000026060	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055015209	UniProtKB/Swiss-Prot
	ENSRNOG00060021538	UniProtKB/Swiss-Prot
	ENSRNOG00065023233	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000030966.5	UniProtKB/Swiss-Prot
	ENSRNOT00055026010	UniProtKB/Swiss-Prot
	ENSRNOT00060037297	UniProtKB/Swiss-Prot
	ENSRNOT00065039689	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.1120.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.720.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Alkaline_phosphatase_core_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARSB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sulfatase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sulfatase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:307404	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	307404	ENTREZGENE
PANTHER	ARYLSULFATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARYLSULFATASE I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Sulfatase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Arsi	PhenoGen
PROSITE	SULFATASE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SULFATASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000026060	RatGTEx
	ENSRNOG00055015209	RatGTEx
	ENSRNOG00060021538	RatGTEx
	ENSRNOG00065023233	RatGTEx
Superfamily-SCOP	Alkaline phosphatase-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6IXE7	ENTREZGENE, UniProtKB/TrEMBL
	ARSI_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Arsi	arylsulfatase family, member I	Arsi	arylsulfatase i	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-27	Arsi	arylsulfatase i	RGD1310242	similar to RIKEN cDNA 9330196J05	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1310242	similar to RIKEN cDNA 9330196J05	RGD1310242_predicted	similar to RIKEN cDNA 9330196J05 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310242_predicted	similar to RIKEN cDNA 9330196J05 (predicted)	LOC307404_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307404_predicted	similar to RIKEN cDNA 9330196J05 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD