Symbol:
Tnfrsf14
Name:
TNF receptor superfamily member 14
RGD ID:
1310115
Description:
Predicted to enable cytokine binding activity; receptor ligand activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including defense response to bacterium; negative regulation of adaptive immune memory response; and regulation of T cell activation. Predicted to act upstream of or within negative regulation of CD4-positive, alpha-beta T cell proliferation and positive regulation of peptidyl-tyrosine phosphorylation. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Biomarker of myocardial infarction. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC366518; MGC108903; tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TNFRSF14 (TNF receptor superfamily member 14) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tnfrsf14 (tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tnfrsf14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TNFRSF14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TNFRSF14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnfrsf14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TNFRSF14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tnfrsf14 (TNF receptor superfamily member 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CHKA (choline kinase alpha) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TNFRSF14 (TNF receptor superfamily member 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tnfrsf14 (tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-23c22.5
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:153631
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-23c22.6
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
si:ch211-261n11.8
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
si:ch211-261n11.7
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:153759
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 170,768,413 - 170,776,749 (-) NCBI GRCr8 mRatBN7.2 5 165,486,069 - 165,494,421 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 165,484,262 - 165,493,703 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 168,191,197 - 168,198,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,012,607 - 170,020,302 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 169,975,147 - 169,982,843 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 172,328,259 - 172,337,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 172,328,262 - 172,335,892 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 175,784,222 - 175,792,597 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 171,727,707 - 171,735,340 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 171,738,202 - 171,745,835 (-) NCBI Celera 5 163,692,588 - 163,700,221 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnfrsf14 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO TNFRSF14 (Homo sapiens) 6480464 o and p'-DDT results in increased expression of TNFRSF14 mRNA CTD PMID:18204070 Tnfrsf14 Rat 1,1,1-trichloroethane increases expression ISO Tnfrsf14 (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Tnfrsf14 Rat 1,2-dimethylhydrazine decreases expression ISO Tnfrsf14 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TNFRSF14 mRNA CTD PMID:22206623 Tnfrsf14 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF14 mRNA CTD PMID:32741896 Tnfrsf14 Rat 17beta-estradiol decreases expression ISO Tnfrsf14 (Mus musculus) 6480464 Estradiol results in decreased expression of TNFRSF14 mRNA CTD PMID:39298647 Tnfrsf14 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF14 mRNA CTD PMID:32741896 Tnfrsf14 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Tnfrsf14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tnfrsf14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF14 mRNA CTD PMID:14718646 and PMID:21570461 Tnfrsf14 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFRSF14 mRNA CTD PMID:20106945 and PMID:21632981 Tnfrsf14 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of TNFRSF14 mRNA CTD PMID:21346803 Tnfrsf14 Rat 4,4'-sulfonyldiphenol decreases expression ISO Tnfrsf14 (Mus musculus) 6480464 bisphenol S results in decreased expression of TNFRSF14 mRNA CTD PMID:39298647 Tnfrsf14 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TNFRSF14 mRNA CTD PMID:24780913 Tnfrsf14 Rat 7,12-dimethyltetraphene increases expression ISO TNFRSF14 (Homo sapiens) 6480464 9 more ... CTD PMID:21527772 Tnfrsf14 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TNFRSF14 mRNA CTD PMID:31881176 Tnfrsf14 Rat actinomycin D multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TNFRSF14 mRNA CTD PMID:38460933 Tnfrsf14 Rat actinomycin D increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Dactinomycin results in increased expression of TNFRSF14 mRNA CTD PMID:38460933 Tnfrsf14 Rat aflatoxin B1 increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TNFRSF14 mRNA CTD PMID:21641981 Tnfrsf14 Rat all-trans-retinoic acid increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Tretinoin results in increased expression of TNFRSF14 mRNA CTD PMID:15498508 more ... Tnfrsf14 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of TNFRSF14 mRNA CTD PMID:35163327 Tnfrsf14 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of TNFRSF14 mRNA CTD PMID:30779732 Tnfrsf14 Rat antirheumatic drug decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TNFRSF14 mRNA CTD PMID:24449571 Tnfrsf14 Rat aripiprazole multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in decreased expression of TNFRSF14 mRNA CTD PMID:31476115 Tnfrsf14 Rat aristolochic acid A decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TNFRSF14 mRNA CTD PMID:33212167 Tnfrsf14 Rat arsane multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of TNFRSF14 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of TNFRSF14 mRNA CTD PMID:19962721 and PMID:32525701 Tnfrsf14 Rat arsenic atom multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of TNFRSF14 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of TNFRSF14 mRNA CTD PMID:19962721 and PMID:32525701 Tnfrsf14 Rat arsenous acid decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF14 mRNA CTD PMID:17530438 Tnfrsf14 Rat benzo[a]pyrene increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TNFRSF14 mRNA CTD PMID:21632981 and PMID:22316170 Tnfrsf14 Rat benzo[a]pyrene increases expression ISO Tnfrsf14 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TNFRSF14 mRNA CTD PMID:25908611 Tnfrsf14 Rat benzo[a]pyrene diol epoxide I increases expression ISO TNFRSF14 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tnfrsf14 Rat bis(2-ethylhexyl) phthalate increases expression ISO Tnfrsf14 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TNFRSF14 mRNA CTD PMID:28085963 Tnfrsf14 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNFRSF14 mRNA CTD PMID:25181051 Tnfrsf14 Rat bisphenol A increases methylation ISO Tnfrsf14 (Mus musculus) 6480464 bisphenol A results in increased methylation of TNFRSF14 promoter CTD PMID:27312807 Tnfrsf14 Rat bisphenol A increases expression ISO TNFRSF14 (Homo sapiens) 6480464 bisphenol A results in increased expression of TNFRSF14 mRNA CTD PMID:27685785 Tnfrsf14 Rat cadmium dichloride increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TNFRSF14 mRNA CTD PMID:38568856 Tnfrsf14 Rat camptothecin increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Camptothecin results in increased expression of TNFRSF14 mRNA CTD PMID:38460933 Tnfrsf14 Rat chlorpromazine increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Chlorpromazine analog results in increased expression of TNFRSF14 mRNA CTD PMID:15924885 Tnfrsf14 Rat chlorpyrifos increases expression ISO Tnfrsf14 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TNFRSF14 mRNA CTD PMID:32715474 Tnfrsf14 Rat cisplatin increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Cisplatin results in increased expression of TNFRSF14 mRNA CTD PMID:27594783 Tnfrsf14 Rat cisplatin multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in increased expression of TNFRSF14 mRNA] and jinfukang promotes the reaction [Cisplatin results in increased expression of TNFRSF14 mRNA] CTD PMID:27392435 Tnfrsf14 Rat cocaine increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Cocaine results in increased expression of TNFRSF14 mRNA CTD PMID:20948987 Tnfrsf14 Rat copper(II) sulfate decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TNFRSF14 mRNA CTD PMID:19549813 Tnfrsf14 Rat cyclophosphamide increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of TNFRSF14 mRNA CTD PMID:21527772 Tnfrsf14 Rat diarsenic trioxide decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF14 mRNA CTD PMID:17530438 Tnfrsf14 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of TNFRSF14 mRNA CTD PMID:21161181 Tnfrsf14 Rat doxorubicin increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Doxorubicin results in increased expression of TNFRSF14 mRNA CTD PMID:29803840 Tnfrsf14 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TNFRSF14 mRNA CTD PMID:29391264 Tnfrsf14 Rat ethyl methanesulfonate increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of TNFRSF14 mRNA CTD PMID:23649840 Tnfrsf14 Rat etoposide increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Etoposide results in increased expression of TNFRSF14 mRNA CTD PMID:21527772 Tnfrsf14 Rat exemestane increases expression ISO TNFRSF14 (Homo sapiens) 6480464 exemestane results in increased expression of TNFRSF14 mRNA CTD PMID:17254854 Tnfrsf14 Rat folic acid affects expression ISO TNFRSF14 (Homo sapiens) 6480464 Folic Acid affects the expression of TNFRSF14 mRNA CTD PMID:16361273 Tnfrsf14 Rat FR900359 decreases phosphorylation ISO TNFRSF14 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of TNFRSF14 protein CTD PMID:37730182 Tnfrsf14 Rat genistein increases expression ISO Tnfrsf14 (Mus musculus) 6480464 Genistein results in increased expression of TNFRSF14 mRNA CTD PMID:32186404 Tnfrsf14 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TNFRSF14 mRNA CTD PMID:22061828 Tnfrsf14 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of TNFRSF14 mRNA CTD PMID:20097248 Tnfrsf14 Rat lipopolysaccharide increases expression ISO Tnfrsf14 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TNFRSF14 mRNA CTD PMID:26582142 Tnfrsf14 Rat methyl methanesulfonate increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TNFRSF14 mRNA CTD PMID:23649840 Tnfrsf14 Rat methylparaben decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 methylparaben results in decreased expression of TNFRSF14 mRNA CTD PMID:38568856 Tnfrsf14 Rat Nutlin-3 multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TNFRSF14 mRNA CTD PMID:38460933 Tnfrsf14 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of TNFRSF14 mRNA CTD PMID:25729387 Tnfrsf14 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TNFRSF14 mRNA CTD PMID:25729387 Tnfrsf14 Rat ozone multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TNFRSF14 mRNA and [Aripiprazole co-treated with Ozone] results in decreased expression of TNFRSF14 mRNA CTD PMID:31476115 and PMID:35430440 Tnfrsf14 Rat ozone multiple interactions ISO Tnfrsf14 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TNFRSF14 mRNA CTD PMID:34911549 Tnfrsf14 Rat p-menthan-3-ol increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Menthol results in increased expression of TNFRSF14 mRNA CTD PMID:26760959 Tnfrsf14 Rat paracetamol decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TNFRSF14 mRNA CTD PMID:29067470 Tnfrsf14 Rat phenobarbital affects expression ISO TNFRSF14 (Homo sapiens) 6480464 Phenobarbital affects the expression of TNFRSF14 mRNA CTD PMID:19159669 Tnfrsf14 Rat pirinixic acid multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TNFRSF14 mRNA CTD PMID:19710929 Tnfrsf14 Rat pirinixic acid decreases expression ISO Tnfrsf14 (Mus musculus) 6480464 pirinixic acid results in decreased expression of TNFRSF14 mRNA CTD PMID:17426115 Tnfrsf14 Rat propanal decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of TNFRSF14 mRNA CTD PMID:26079696 Tnfrsf14 Rat quercetin increases expression ISO TNFRSF14 (Homo sapiens) 6480464 Quercetin results in increased expression of TNFRSF14 mRNA CTD PMID:21632981 Tnfrsf14 Rat sodium arsenate multiple interactions ISO TNFRSF14 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of TNFRSF14 mRNA CTD PMID:32525701 Tnfrsf14 Rat tamibarotene increases expression ISO TNFRSF14 (Homo sapiens) 6480464 tamibarotene results in increased expression of TNFRSF14 mRNA CTD PMID:15498508 Tnfrsf14 Rat temozolomide decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TNFRSF14 mRNA CTD PMID:31758290 Tnfrsf14 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF14 mRNA CTD PMID:32741896 Tnfrsf14 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TNFRSF14 mRNA CTD PMID:34492290 Tnfrsf14 Rat thiram decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Thiram results in decreased expression of TNFRSF14 mRNA CTD PMID:38568856 Tnfrsf14 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of TNFRSF14 mRNA CTD PMID:25729387 Tnfrsf14 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TNFRSF14 mRNA CTD PMID:25729387 Tnfrsf14 Rat triphenyl phosphate affects expression ISO TNFRSF14 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TNFRSF14 mRNA CTD PMID:37042841 Tnfrsf14 Rat urethane decreases expression ISO TNFRSF14 (Homo sapiens) 6480464 Urethane results in decreased expression of TNFRSF14 mRNA CTD PMID:28818685 Tnfrsf14 Rat valproic acid increases methylation ISO TNFRSF14 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TNFRSF14 gene CTD PMID:29154799 Tnfrsf14 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TNFRSF14 mRNA CTD PMID:35594946 Tnfrsf14 Rat XL147 multiple interactions ISO Tnfrsf14 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of TNFRSF14 mRNA] CTD PMID:29891994 Tnfrsf14 Rat zoledronic acid increases expression ISO TNFRSF14 (Homo sapiens) 6480464 zoledronic acid results in increased expression of TNFRSF14 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1,1-trichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) camptothecin (ISO) chlorpromazine (ISO) chlorpyrifos (ISO) cisplatin (ISO) cocaine (ISO) copper(II) sulfate (ISO) cyclophosphamide (ISO) diarsenic trioxide (ISO) diethyl maleate (EXP) doxorubicin (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) etoposide (ISO) exemestane (ISO) folic acid (ISO) FR900359 (ISO) genistein (ISO) gentamycin (EXP) irinotecan (EXP) lipopolysaccharide (ISO) methyl methanesulfonate (ISO) methylparaben (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) phenobarbital (ISO) pirinixic acid (ISO) propanal (ISO) quercetin (ISO) sodium arsenate (ISO) tamibarotene (ISO) temozolomide (ISO) testosterone (EXP) thioacetamide (EXP) thiram (ISO) topotecan (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO) XL147 (ISO) zoledronic acid (ISO)
Tnfrsf14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 170,768,413 - 170,776,749 (-) NCBI GRCr8 mRatBN7.2 5 165,486,069 - 165,494,421 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 165,484,262 - 165,493,703 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 168,191,197 - 168,198,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,012,607 - 170,020,302 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 169,975,147 - 169,982,843 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 172,328,259 - 172,337,221 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 172,328,262 - 172,335,892 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 175,784,222 - 175,792,597 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 171,727,707 - 171,735,340 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 171,738,202 - 171,745,835 (-) NCBI Celera 5 163,692,588 - 163,700,221 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
TNFRSF14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 2,554,234 - 2,563,829 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 2,555,639 - 2,565,382 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 2,487,810 - 2,495,268 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 2,479,150 - 2,486,613 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 2,521,454 - 2,528,915 NCBI Celera 1 90,732 - 98,195 (-) NCBI Celera Cytogenetic Map 1 p36.32 NCBI HuRef 1 1,767,040 - 1,774,503 (+) NCBI HuRef CHM1_1 1 2,474,873 - 2,482,336 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 1,997,007 - 2,005,473 (+) NCBI T2T-CHM13v2.0
Tnfrsf14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 155,002,944 - 155,013,077 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 155,006,390 - 155,013,020 (-) Ensembl GRCm39 Ensembl GRCm38 4 154,918,487 - 154,928,620 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 154,921,933 - 154,928,563 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 154,296,319 - 154,302,186 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 153,766,010 - 153,771,877 (-) NCBI MGSCv36 mm8 Celera 4 157,193,781 - 157,199,645 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 85.81 NCBI
Tnfrsf14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955486 8,670,182 - 8,684,677 (-) NCBI ChiLan1.0 ChiLan1.0
TNFRSF14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 225,684,004 - 225,692,010 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 224,344,543 - 224,352,496 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 1,288,493 - 1,296,532 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 2,427,421 - 2,435,615 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 2,427,631 - 2,435,615 (+) Ensembl panpan1.1 panPan2
TNFRSF14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 57,386,190 - 57,416,864 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 57,411,529 - 57,416,512 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 57,425,462 - 57,430,262 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 57,611,566 - 57,621,030 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 57,614,515 - 57,621,010 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 57,607,109 - 57,611,909 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 57,499,417 - 57,504,217 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 57,889,145 - 57,893,945 (+) NCBI UU_Cfam_GSD_1.0
Tnfrsf14
TNFRSF14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 128,992,572 - 128,999,829 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 128,992,489 - 129,000,338 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 33,335,588 - 33,343,167 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnfrsf14
.
Predicted Target Of
Count of predictions: 373 Count of miRNA genes: 204 Interacting mature miRNAs: 239 Transcripts: ENSRNOT00000018494 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH130715
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 165,486,118 - 165,486,270 (+) MAPPER mRatBN7.2 Rnor_6.0 5 172,328,309 - 172,328,460 NCBI Rnor6.0 Rnor_5.0 5 175,784,272 - 175,784,423 UniSTS Rnor5.0 RGSC_v3.4 5 171,727,757 - 171,727,908 UniSTS RGSC3.4 Celera 5 163,692,638 - 163,692,789 UniSTS RH 3.4 Map 5 1155.5 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
109
91
90
59
25
59
6
218
97
89
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018494 ⟹ ENSRNOP00000018492
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 165,486,064 - 165,493,703 (-) Ensembl Rnor_6.0 Ensembl 5 172,328,262 - 172,335,892 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103957 ⟹ ENSRNOP00000096903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 165,484,262 - 165,493,703 (-) Ensembl
RefSeq Acc Id:
NM_001015034 ⟹ NP_001015034
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,046 (-) NCBI mRatBN7.2 5 165,486,069 - 165,493,703 (-) NCBI Rnor_6.0 5 172,328,259 - 172,335,892 (-) NCBI Rnor_5.0 5 175,784,222 - 175,792,597 (-) NCBI RGSC_v3.4 5 171,727,707 - 171,735,340 (-) RGD Celera 5 163,692,588 - 163,700,221 (-) RGD
Sequence:
CACTTTTAGTTTTAGCTGGGGCTCATGAGAGTGTGTGAGGAGGTCCAAAGTCCATGGGGCTCCTGGCCTGCAGTGTCTTGATTAAGAAAATGGAACCTCTCCCGGGATGGGAGTCGTCACCCTGGAGC
hide sequence
RefSeq Acc Id:
XM_006239586 ⟹ XP_006239648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,665 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,324 (-) NCBI Rnor_6.0 5 172,328,259 - 172,337,219 (-) NCBI Rnor_5.0 5 175,784,222 - 175,792,597 (-) NCBI
Sequence:
AGGGTCCAGCTCACTGTGGGTAGTAGTATCATCCCTGGGCTCTGGTGGTCCTAGATTTTTATAA
hide sequence
RefSeq Acc Id:
XM_006239587 ⟹ XP_006239649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,668 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,330 (-) NCBI Rnor_6.0 5 172,328,259 - 172,337,220 (-) NCBI Rnor_5.0 5 175,784,222 - 175,792,597 (-) NCBI
Sequence:
GAGGGTCCAGCTCACTGTGGGTAGTAGTATCATCCCTGGGCTCTGGTGGTCCTAGATTTTTATAAGAAAGCAGGCTGAACAAGTTGTGGATAACAAGCCGGTAAGAAGCACCCCTGCATAGCTTCTGC
hide sequence
RefSeq Acc Id:
XM_039110507 ⟹ XP_038966435
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,667 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,328 (-) NCBI
RefSeq Acc Id:
XM_039110508 ⟹ XP_038966436
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,458 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,110 (-) NCBI
RefSeq Acc Id:
XM_039110509 ⟹ XP_038966437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,668 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,330 (-) NCBI
RefSeq Acc Id:
XM_039110510 ⟹ XP_038966438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,744 (-) NCBI mRatBN7.2 5 165,486,069 - 165,494,421 (-) NCBI
RefSeq Acc Id:
XM_039110511 ⟹ XP_038966439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,031 (-) NCBI mRatBN7.2 5 165,486,069 - 165,493,687 (-) NCBI
RefSeq Acc Id:
XM_063288144 ⟹ XP_063144214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,770,207 - 170,776,663 (-) NCBI
RefSeq Acc Id:
XM_063288145 ⟹ XP_063144215
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,749 (-) NCBI
RefSeq Acc Id:
XM_063288146 ⟹ XP_063144216
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,458 (-) NCBI
RefSeq Acc Id:
XM_063288147 ⟹ XP_063144217
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,729 (-) NCBI
RefSeq Acc Id:
XM_063288148 ⟹ XP_063144218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 170,768,413 - 170,776,732 (-) NCBI
RefSeq Acc Id:
NP_001015034 ⟸ NM_001015034
- Peptide Label:
precursor
- UniProtKB:
Q5BK53 (UniProtKB/TrEMBL), F7F4X8 (UniProtKB/TrEMBL)
- Sequence:
MEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCISGYFCENQ
hide sequence
RefSeq Acc Id:
XP_006239649 ⟸ XM_006239587
- Peptide Label:
isoform X5
- UniProtKB:
F7F4X8 (UniProtKB/TrEMBL)
- Sequence:
MGLLACSVLIKKMEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECC
hide sequence
RefSeq Acc Id:
XP_006239648 ⟸ XM_006239586
- Peptide Label:
isoform X4
- UniProtKB:
A6IUM8 (UniProtKB/TrEMBL), F7F4X8 (UniProtKB/TrEMBL)
- Sequence:
MGLLACSVLIKKMEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000018492 ⟸ ENSRNOT00000018494
RefSeq Acc Id:
XP_038966438 ⟸ XM_039110510
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038966437 ⟸ XM_039110509
- Peptide Label:
isoform X2
- UniProtKB:
F7F4X8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966435 ⟸ XM_039110507
- Peptide Label:
isoform X1
- UniProtKB:
F7F4X8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966436 ⟸ XM_039110508
- Peptide Label:
isoform X1
- UniProtKB:
F7F4X8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966439 ⟸ XM_039110511
- Peptide Label:
isoform X8
Ensembl Acc Id:
ENSRNOP00000096903 ⟸ ENSRNOT00000103957
RefSeq Acc Id:
XP_063144215 ⟸ XM_063288145
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063144218 ⟸ XM_063288148
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_063144217 ⟸ XM_063288147
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063144216 ⟸ XM_063288146
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063144214 ⟸ XM_063288144
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ATG2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-05
Tnfrsf14
TNF receptor superfamily member 14
Tnfrsf14
tumor necrosis factor receptor superfamily, member 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-08-18
Tnfrsf14
tumor necrosis factor receptor superfamily, member 14
Tnfrsf14
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Tnfrsf14
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Tnfrsf14_predicted
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tnfrsf14_predicted
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) (predicted)
Symbol and Name status set to approved
70820 APPROVED
