Advanced Search (OLGA)

Gene: Gtpbp8 (GTP binding protein 8) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gtpbp8

Name:

GTP binding protein 8 (Ensembl:GTP-binding protein 8 (putative))

RGD ID:

1310025

Description:

Predicted to enable GTP binding activity and metal ion binding activity. Predicted to be active in mitochondrion. Orthologous to human GTPBP8 (GTP binding protein 8); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GTP-binding protein 8; GTP-binding protein 8 (putative); LOC360714; MGC108988; RGD1310025; similar to RIKEN cDNA 0610037H22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTPBP8 (GTP binding protein 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gtpbp8 (GTP-binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtpbp8 (GTP binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTPBP8 (GTP binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTPBP8 (GTP binding protein 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtpbp8 (GTP binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTPBP8 (GTP binding protein 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTPBP8 (GTP binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtpbp8 (GTP binding protein 8 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gtpbp8 (GTP-binding protein 8 (putative))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GTPBP8 (GTP binding protein 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:rp71-84d19.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MRX8	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gtpbp8	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	69,451,776 - 69,461,744 (+)	NCBI		GRCr8
mRatBN7.2	11	55,945,778 - 55,955,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	55,945,795 - 55,955,635 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	64,759,473 - 64,769,301 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	57,421,324 - 57,431,152 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	56,491,653 - 56,501,478 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	60,906,990 - 60,916,958 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	60,907,015 - 60,916,842 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	65,019,513 - 65,030,564 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	57,484,578 - 57,494,406 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	57,542,166 - 57,551,994 (+)	NCBI
Celera	11	55,509,382 - 55,519,232 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gtpbp8	Rat	anauxetic dysplasia 3		ISO	GTPBP8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: NEPRO-related condition	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gtpbp8	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of GTPBP8 mRNA	CTD	PMID:22206623
Gtpbp8	Rat	2,2',5,5'-tetrachlorobiphenyl	decreases expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Gtpbp8	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GTPBP8 mRNA	CTD	PMID:33387578
Gtpbp8	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of GTPBP8 mRNA	CTD	PMID:21346803
Gtpbp8	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of GTPBP8 mRNA	CTD	PMID:21346803
Gtpbp8	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of GTPBP8 mRNA	CTD	PMID:21346803
Gtpbp8	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Gtpbp8 (Mus musculus)	6480464	bisphenol S results in increased methylation of GTPBP8 exon	CTD	PMID:33297965
Gtpbp8	Rat	all-trans-retinoic acid	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Tretinoin results in decreased expression of GTPBP8 mRNA	CTD	PMID:33167477
Gtpbp8	Rat	atrazine	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Atrazine results in decreased expression of GTPBP8 mRNA	CTD	PMID:22378314
Gtpbp8	Rat	benzo[a]pyrene	increases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of GTPBP8 mRNA	CTD	PMID:22228805
Gtpbp8	Rat	benzo[a]pyrene	decreases methylation	ISO	GTPBP8 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of GTPBP8 promoter	CTD	PMID:27901495
Gtpbp8	Rat	bisphenol A	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	bisphenol A results in increased expression of GTPBP8 mRNA	CTD	PMID:25047013
Gtpbp8	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of GTPBP8 gene	CTD	PMID:28505145
Gtpbp8	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GTPBP8 mRNA	CTD	PMID:25181051
Gtpbp8	Rat	carbon nanotube	increases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of GTPBP8 mRNA	CTD	PMID:25554681
Gtpbp8	Rat	CGP 52608	multiple interactions	ISO	GTPBP8 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to GTPBP8 gene]	CTD	PMID:28238834
Gtpbp8	Rat	chlorpyrifos	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of GTPBP8 mRNA	CTD	PMID:32715474 and PMID:37019170
Gtpbp8	Rat	cyclosporin A	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Cyclosporine results in increased expression of GTPBP8 mRNA	CTD	PMID:25562108
Gtpbp8	Rat	deguelin	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	deguelin results in increased expression of GTPBP8 mRNA	CTD	PMID:33512557
Gtpbp8	Rat	dexamethasone	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Dexamethasone results in increased expression of GTPBP8 mRNA	CTD	PMID:25047013
Gtpbp8	Rat	Dibutyl phosphate	affects expression	ISO	GTPBP8 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GTPBP8 mRNA	CTD	PMID:37042841
Gtpbp8	Rat	diethylstilbestrol	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of GTPBP8 mRNA	CTD	PMID:36621641
Gtpbp8	Rat	elemental selenium	multiple interactions	ISO	GTPBP8 (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175
Gtpbp8	Rat	elemental selenium	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Selenium results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175
Gtpbp8	Rat	epoxiconazole	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	epoxiconazole results in decreased expression of GTPBP8 mRNA	CTD	PMID:35436446
Gtpbp8	Rat	folic acid	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Folic Acid results in decreased expression of GTPBP8 mRNA	CTD	PMID:25629700
Gtpbp8	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of GTPBP8 gene	CTD	PMID:22079235
Gtpbp8	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of GTPBP8 mRNA	CTD	PMID:25539665
Gtpbp8	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of GTPBP8 mRNA	CTD	PMID:33387578
Gtpbp8	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of GTPBP8 mRNA	CTD	PMID:21396975
Gtpbp8	Rat	ketoconazole	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Ketoconazole results in decreased expression of GTPBP8 mRNA	CTD	PMID:36621641
Gtpbp8	Rat	mercury atom	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Mercury analog results in decreased expression of GTPBP8 mRNA	CTD	PMID:25056781
Gtpbp8	Rat	mercury(0)	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	Mercury analog results in decreased expression of GTPBP8 mRNA	CTD	PMID:25056781
Gtpbp8	Rat	paracetamol	affects expression	ISO	Gtpbp8 (Mus musculus)	6480464	Acetaminophen affects the expression of GTPBP8 mRNA	CTD	PMID:17562736
Gtpbp8	Rat	picoxystrobin	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	picoxystrobin results in increased expression of GTPBP8 mRNA	CTD	PMID:33512557
Gtpbp8	Rat	quercetin	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Quercetin results in decreased expression of GTPBP8 mRNA	CTD	PMID:21632981
Gtpbp8	Rat	selenium atom	multiple interactions	ISO	GTPBP8 (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175
Gtpbp8	Rat	selenium atom	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Selenium results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175
Gtpbp8	Rat	temozolomide	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Temozolomide results in increased expression of GTPBP8 mRNA	CTD	PMID:31758290
Gtpbp8	Rat	testosterone enanthate	affects expression	ISO	GTPBP8 (Homo sapiens)	6480464	testosterone enanthate affects the expression of GTPBP8 mRNA	CTD	PMID:17440010
Gtpbp8	Rat	triphenyl phosphate	affects expression	ISO	GTPBP8 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of GTPBP8 mRNA	CTD	PMID:37042841
Gtpbp8	Rat	triptonide	decreases expression	ISO	Gtpbp8 (Mus musculus)	6480464	triptonide results in decreased expression of GTPBP8 mRNA	CTD	PMID:33045310
Gtpbp8	Rat	valproic acid	affects expression	ISO	Gtpbp8 (Mus musculus)	6480464	Valproic Acid affects the expression of GTPBP8 mRNA	CTD	PMID:17963808
Gtpbp8	Rat	valproic acid	increases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Valproic Acid results in increased expression of GTPBP8 mRNA	CTD	PMID:23179753
Gtpbp8	Rat	valproic acid	affects expression	ISO	GTPBP8 (Homo sapiens)	6480464	Valproic Acid affects the expression of GTPBP8 mRNA	CTD	PMID:25979313
Gtpbp8	Rat	vitamin E	decreases expression	ISO	GTPBP8 (Homo sapiens)	6480464	Vitamin E results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175
Gtpbp8	Rat	vitamin E	multiple interactions	ISO	GTPBP8 (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of GTPBP8 mRNA	CTD	PMID:19244175

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gtpbp8	Rat	mitochondrion	located_in	ISO	GTPBP8 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Gtpbp8	Rat	mitochondrion	located_in	IEA	UniProtKB:Q8N3Z3 and ensembl:ENSP00000373176	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gtpbp8	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN000182855 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gtpbp8	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gtpbp8	Rat	GTP binding	enables	IEA	InterPro:IPR006073 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gtpbp8	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gtpbp8	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gtpbp8	Rat	protein binding	enables	ISO	GTPBP8 (Homo sapiens)	1624291	UniProtKB:Q9UJX2 and PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:18614015

Gtpbp8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	69,451,776 - 69,461,744 (+)	NCBI		GRCr8
mRatBN7.2	11	55,945,778 - 55,955,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	55,945,795 - 55,955,635 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	64,759,473 - 64,769,301 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	57,421,324 - 57,431,152 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	56,491,653 - 56,501,478 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	60,906,990 - 60,916,958 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	60,907,015 - 60,916,842 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	65,019,513 - 65,030,564 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	57,484,578 - 57,494,406 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	57,542,166 - 57,551,994 (+)	NCBI
Celera	11	55,509,382 - 55,519,232 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

GTPBP8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	112,990,984 - 113,001,969 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	112,990,984 - 113,015,060 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	112,709,831 - 112,720,816 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	114,192,490 - 114,202,911 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	111,118,142 - 111,128,559 (+)	NCBI		Celera
Cytogenetic Map	3	q13.2	NCBI
HuRef	3	110,093,350 - 110,103,766 (+)	NCBI		HuRef
CHM1_1	3	112,673,347 - 112,683,763 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	115,711,946 - 115,722,926 (+)	NCBI		T2T-CHM13v2.0

Gtpbp8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	44,559,242 - 44,566,726 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	44,557,131 - 44,566,726 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	44,738,879 - 44,746,363 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	44,736,768 - 44,746,363 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	44,738,992 - 44,746,476 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	44,658,318 - 44,665,691 (-)	NCBI		MGSCv36	mm8
Celera	16	45,099,482 - 45,106,966 (-)	NCBI		Celera
Cytogenetic Map	16	B4	NCBI
cM Map	16	29.05	NCBI

Gtpbp8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	13,218,925 - 13,232,111 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955427	13,219,503 - 13,235,198 (+)	NCBI	ChiLan1.0	ChiLan1.0

GTPBP8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	110,993,066 - 111,004,433 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	110,997,846 - 111,009,213 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	110,140,853 - 110,152,046 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	117,065,133 - 117,075,587 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	117,065,130 - 117,075,587 (+)	Ensembl	panpan1.1		panPan2

GTPBP8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	17,375,959 - 17,451,613 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	17,375,996 - 17,388,940 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	17,479,232 - 17,555,161 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	17,620,277 - 17,695,948 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	17,620,313 - 17,633,527 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	17,424,644 - 17,500,389 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	17,472,083 - 17,548,199 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	18,021,726 - 18,097,753 (+)	NCBI		UU_Cfam_GSD_1.0

Gtpbp8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	136,846,564 - 136,895,715 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936536	625,563 - 638,366 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936536	582,222 - 656,444 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTPBP8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	146,909,261 - 146,932,367 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	146,822,781 - 146,932,864 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	156,379,759 - 156,534,285 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTPBP8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	67,835,885 - 67,847,677 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	67,836,912 - 67,846,832 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	98,633,103 - 98,644,341 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtpbp8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	35,530,651 - 35,540,716 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	35,522,937 - 35,540,759 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gtpbp8
35 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	173
Count of miRNA genes:	123
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000002797
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

RH138751

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	11	69,456,425 - 69,456,599 (+)	Marker Load Pipeline
mRatBN7.2	11	55,950,427 - 55,950,601 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	60,911,640 - 60,911,813	NCBI	Rnor6.0
Rnor_5.0	11	65,024,162 - 65,024,335	UniSTS	Rnor5.0
RGSC_v3.4	11	57,489,203 - 57,489,376	UniSTS	RGSC3.4
Celera	11	55,514,007 - 55,514,180	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138868

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	55,955,452 - 55,955,606 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	60,916,665 - 60,916,818	NCBI	Rnor6.0
Rnor_5.0	11	65,029,307 - 65,029,460	UniSTS	Rnor5.0
RGSC_v3.4	11	57,494,228 - 57,494,381	UniSTS	RGSC3.4
Celera	11	55,519,054 - 55,519,207	UniSTS
Cytogenetic Map	11	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001025015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006248340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005491038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002797 ⟹ ENSRNOP00000002797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	55,945,795 - 55,955,635 (+)	Ensembl
Rnor_6.0 Ensembl	11	60,907,015 - 60,916,842 (+)	Ensembl

RefSeq Acc Id:

NM_001025015 ⟹ NP_001020186

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	69,451,801 - 69,461,629 (+)	NCBI
mRatBN7.2	11	55,945,803 - 55,955,631 (+)	NCBI
Rnor_6.0	11	60,907,015 - 60,916,843 (+)	NCBI
Rnor_5.0	11	65,019,513 - 65,030,564 (+)	NCBI
RGSC_v3.4	11	57,484,578 - 57,494,406 (+)	RGD
Celera	11	55,509,382 - 55,519,232 (+)	RGD

Sequence:

show sequence

GGAGAAAAAAAAATGGCGGCTACTAGGTTATGGCATAGAACGGGAAGGCTCCTTGAGATAGCGTCGGCATTTGGGCCTTGGCCCGGGGTTTACAGCACGTCCCCTGCCTTCGCTGAAGTACTAAGGAT
GCCACAGAAACAGCTAAGGAAAGTAGTGTACCCGCTGCGGGAACTGGAGCAGCACCTCGTCACGGACTCTAGGCCTGGCCTCATCGAACAGAGACTCTTCGACCCGAGCCTGGAGGACATCGGGAGGG
CGGAGAGCGTCTTCGCCGCCACGGTCCGGAACCGCATTGAGTACCTCAGCTCCGCCGTCCGCCTAGACCACGCCCCGAGTTTGCGGCAGCCGGAGGTGTGTTTCATAGGCCGAAGCAATGTTGGAAAA
TCCTCTTTGATAAAGGCCTTATTTTCCATGGCCCCTGATGTAGAAGTCAGGATCTCAAAAAAACCGGGGCACACAAAGAAAATGAATTTTTTCAAAGTTGGAAAACATTTTACCTTGGTGGACATGCC
AGGGTATGGCTATAGAGCACCCGAAGACTTTGTTGACATGGTAGAGACTTATCTAAAAGAACGAAATAATTTGAAGAGAACATTTTTATTAGTGGATAGCGTTGTTGGAATTACAAAGTTAGACAATA
TCGCCATAGAAATGTGTGAAGAATTCGCATTGCCTTATGTGATGATATTAACAAAAATTGACAAATCTTCCAAGGGGTATCTTTTAAAACAAGTGCTCCAGATTCAGGAGTTCGTTAACACGCAGACA
CAAGGCTGTTTTCCTCAGCTGTTCCCTATAAGCGCAGTAACCTATTCTGGAGTTCATCTGTTGAAATGCTTTATAGCAGATATAACAGGAAGTCTTAAGTAAACGCTCCCAGAGTGGATGATGTTTCA
AAGTTCTTCTGGTCAACTGGAATTAAATATGGAGAAGAATGCCAATATTGTTTTAAATATTGTGCATCTCAACTTGAAGGAAATTGGGCTTTTTAAAAAAAAAAAAAAAACCTGGATTACCCCTGAAG
CAAGAACAAATGTGTTGGGGGTAAGGGTTACAAATAATTCATTAAATCATACTGTTCATTAGGACAGATGCTAGCTGGCTTTCCTATTTTAAGTGACAAGTCCAAAAGCATATACAAATTCACGAAAT
GAGACCCTGCTTCTATGCAGAGGTTGAATAAATTGGGTTTTTCTCTTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039088481 ⟹ XP_038944409

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	69,451,776 - 69,461,744 (+)	NCBI
mRatBN7.2	11	55,945,778 - 55,955,743 (+)	NCBI

RefSeq Acc Id:

XR_005491038

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	69,451,777 - 69,458,320 (+)	NCBI
mRatBN7.2	11	55,945,779 - 55,952,374 (+)	NCBI


Protein RefSeqs	NP_001020186	(Get FASTA)	NCBI Sequence Viewer
	XP_038944409	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91236	(Get FASTA)	NCBI Sequence Viewer
	EDM11151	(Get FASTA)	NCBI Sequence Viewer
	EDM11152	(Get FASTA)	NCBI Sequence Viewer
	EDM11153	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002797
	ENSRNOP00000002797.3
GenBank Protein	Q5BK22	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020186 ⟸ NM_001025015

- UniProtKB:

Q5BK22 (UniProtKB/Swiss-Prot), A6IQZ8 (UniProtKB/TrEMBL), A6IQZ9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATRLWHRTGRLLEIASAFGPWPGVYSTSPAFAEVLRMPQKQLRKVVYPLRELEQHLVTDSRPGLIEQRLFDPSLEDIGRAESVFAATVRNRIEYLSSAVRLDHAPSLRQPEVCFIGRSNVGKSSLI
KALFSMAPDVEVRISKKPGHTKKMNFFKVGKHFTLVDMPGYGYRAPEDFVDMVETYLKERNNLKRTFLLVDSVVGITKLDNIAIEMCEEFALPYVMILTKIDKSSKGYLLKQVLQIQEFVNTQTQGCF
PQLFPISAVTYSGVHLLKCFIADITGSLK

hide sequence

Ensembl Acc Id:

ENSRNOP00000002797 ⟸ ENSRNOT00000002797

RefSeq Acc Id:	XP_038944409 ⟸ XM_039088481
- Peptide Label:	isoform X1

Protein Domains

EngB-type G G

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK22-F1-model_v2	AlphaFold	Q5BK22	1-285	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698147

Promoter ID:

EPDNEW_R8671

Type:

multiple initiation site

Name:

Gtpbp8_1

Description:

GTP-binding protein 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	60,907,018 - 60,907,078	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-21356	BioCyc
Ensembl Genes	ENSRNOG00000002044	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002797	ENTREZGENE
	ENSRNOT00000002797.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7322967	IMAGE-MGC_LOAD
InterPro	EngB_GTPase	UniProtKB/Swiss-Prot
	G_ENGB_dom	UniProtKB/Swiss-Prot
	GTP-bd_ribosome_bio_YsxC	UniProtKB/Swiss-Prot
	GTP_binding_domain	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:360714	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108988	IMAGE-MGC_LOAD
NCBI Gene	360714	ENTREZGENE
PANTHER	GTP-BINDING PROTEIN 8	UniProtKB/Swiss-Prot
	GTP-BINDING PROTEIN 8	UniProtKB/Swiss-Prot
Pfam	MMR_HSR1	UniProtKB/Swiss-Prot
PhenoGen	Gtpbp8	PhenoGen
PROSITE	G_ENGB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002044	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A6IQZ8	ENTREZGENE, UniProtKB/TrEMBL
	A6IQZ9	ENTREZGENE, UniProtKB/TrEMBL
	A6IR00_RAT	UniProtKB/TrEMBL
	GTPB8_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-08-06	Gtpbp8	GTP binding protein 8	Gtpbp8	GTP-binding protein 8 (putative)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Gtpbp8	GTP-binding protein 8 (putative)	RGD1310025	similar to RIKEN cDNA 0610037H22	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310025	similar to RIKEN cDNA 0610037H22	RGD1310025_predicted	similar to RIKEN cDNA 0610037H22 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310025_predicted	similar to RIKEN cDNA 0610037H22 (predicted)	LOC360714_predicted		Symbol and Name status set to approved	1331353	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar