Alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase)

Gene: Alg2 (ALG2, alpha-1,3/1,6-mannosyltransferase) Rattus norvegicus

Analyze

Symbol:

Alg2

Name:

ALG2, alpha-1,3/1,6-mannosyltransferase

RGD ID:

1309940

Description:

Predicted to enable alpha-1,3-mannosyltransferase activity; calcium-dependent protein binding activity; and protein heterodimerization activity. Predicted to be involved in dolichol-linked oligosaccharide biosynthetic process and response to calcium ion. Predicted to be located in membrane; nucleus; and perinuclear region of cytoplasm. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation Ii and congenital myasthenic syndrome 14. Orthologous to human ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase); PARTICIPATES IN N-linked glycan biosynthetic pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-1,3-mannosyltransferase ALG2; alpha-1,3/1,6-mannosyltransferase ALG2; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae); LOC313231

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ALG2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	alg2 (ALG2 alpha-1,3/1,6-mannosyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ALG2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Alg2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	algn-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	alg2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	66,564,328 - 66,568,887 (-)	NCBI		GRCr8
mRatBN7.2	5	61,768,738 - 61,773,297 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	61,768,740 - 61,773,297 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	63,740,627 - 63,745,178 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	65,559,929 - 65,564,480 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	65,529,399 - 65,533,952 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	63,187,466 - 63,192,025 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	63,187,468 - 63,192,025 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	67,707,025 - 67,711,584 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	64,092,017 - 64,096,576 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	64,098,709 - 64,101,565 (-)	NCBI
Celera	5	65,819,685 - 65,824,244 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation (ISO)

congenital disorder of glycosylation Ii (ISO)

congenital disorder of glycosylation type II (ISO)

congenital disorder of glycosylation type IIa (ISO)

congenital myasthenic syndrome (ISO)

congenital myasthenic syndrome 14 (ISO)

genetic disease (ISO)

intellectual disability (ISO)

nephronophthisis (ISO)

thoracic aortic aneurysm (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-trichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP)

amiodarone (ISO)

azoxystrobin (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

calcium atom (ISO)

calcium(0) (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dibutyl phthalate (EXP,ISO)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

glafenine (EXP)

glyphosate (EXP)

imidacloprid (EXP)

ivermectin (ISO)

leflunomide (ISO)

nickel atom (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

Salinomycin (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thiabendazole (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

dolichol-linked oligosaccharide biosynthetic process (ISO)

oligosaccharide-lipid intermediate biosynthetic process (IBA)

protein glycosylation (ISO)

protein N-linked glycosylation (ISO)

Cellular Component

cytoplasmic side of endoplasmic reticulum membrane (ISO)

endomembrane system (IEA)

Molecular Function

alpha-1,3-mannosyltransferase activity (IBA,ISO)

GDP-Man:Man1GlcNAc2-PP-Dol alpha-1,3-mannosyltransferase activity (IEA,ISO)

GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase activity (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

N-linked glycan biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:11278427	PMID:12445460	PMID:12477932	PMID:12684507	PMID:14999017	PMID:16996505	PMID:17045351	PMID:17196169	PMID:19946888

Genomics

Comparative Map Data

Alg2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	66,564,328 - 66,568,887 (-)	NCBI		GRCr8
mRatBN7.2	5	61,768,738 - 61,773,297 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	61,768,740 - 61,773,297 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	63,740,627 - 63,745,178 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	65,559,929 - 65,564,480 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	65,529,399 - 65,533,952 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	63,187,466 - 63,192,025 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	63,187,468 - 63,192,025 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	67,707,025 - 67,711,584 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	64,092,017 - 64,096,576 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	64,098,709 - 64,101,565 (-)	NCBI
Celera	5	65,819,685 - 65,824,244 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

ALG2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	99,216,425 - 99,221,942 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	99,216,425 - 99,221,942 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	101,978,707 - 101,984,224 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	101,018,528 - 101,024,067 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	72,492,570 - 72,498,109 (-)	NCBI		Celera
Cytogenetic Map	9	q22.33	NCBI
HuRef	9	71,577,356 - 71,582,895 (-)	NCBI		HuRef
CHM1_1	9	102,125,156 - 102,130,695 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	111,388,129 - 111,393,646 (-)	NCBI		T2T-CHM13v2.0

Alg2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	47,469,833 - 47,474,367 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	47,465,067 - 47,474,333 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	47,469,833 - 47,474,367 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	47,465,067 - 47,474,333 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	47,482,705 - 47,487,239 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	47,490,934 - 47,495,425 (-)	NCBI		MGSCv36	mm8
Celera	4	47,492,429 - 47,496,952 (-)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	26.03	NCBI

Alg2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	26,423,243 - 26,432,024 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	26,423,243 - 26,427,384 (+)	NCBI	ChiLan1.0	ChiLan1.0

ALG2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	40,235,393 - 40,240,296 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	40,238,131 - 40,242,676 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	70,306,294 - 70,311,897 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	98,424,958 - 98,430,698 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	98,424,958 - 98,430,698 (-)	Ensembl	panpan1.1		panPan2

ALG2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	56,274,494 - 56,279,456 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	56,275,495 - 56,279,412 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	54,705,753 - 54,710,071 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	57,382,875 - 57,387,186 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	57,381,884 - 57,387,206 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	55,887,334 - 55,891,651 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	55,912,317 - 55,916,631 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	56,611,473 - 56,616,005 (-)	NCBI		UU_Cfam_GSD_1.0

Alg2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	171,179,090 - 171,183,169 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	7,725,438 - 7,731,486 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	7,725,444 - 7,730,869 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALG2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	240,979,216 - 240,984,823 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	240,973,022 - 240,984,816 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	269,210,057 - 269,215,674 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALG2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	40,202,745 - 40,208,263 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	40,202,748 - 40,208,342 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	2,323,007 - 2,327,641 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alg2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	1,771,530 - 1,777,711 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624825	1,771,408 - 1,775,950 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Alg2
16 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	368
Count of miRNA genes:	215
Interacting mature miRNAs:	268
Transcripts:	ENSRNOT00000008913
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat

Markers in Region

RH128408

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	61,768,925 - 61,769,130 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	63,187,654 - 63,187,858	NCBI	Rnor6.0
Rnor_5.0	5	67,707,213 - 67,707,417	UniSTS	Rnor5.0
RGSC_v3.4	5	64,092,205 - 64,092,409	UniSTS	RGSC3.4
Celera	5	65,823,852 - 65,824,056	UniSTS
RH 3.4 Map	5	400.0	UniSTS
Cytogenetic Map	5	q22	UniSTS

RH143257

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	61,771,317 - 61,772,953 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	63,190,046 - 63,191,681	NCBI	Rnor6.0
Rnor_5.0	5	67,709,605 - 67,711,240	UniSTS	Rnor5.0
RGSC_v3.4	5	64,094,597 - 64,096,232	UniSTS	RGSC3.4
Celera	5	65,820,029 - 65,821,664	UniSTS
RH 3.4 Map	5	417.2	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	26	35	20	17	20		3	74	35	41	11
Low		17	22	21	2	21	8	8					8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP504317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000008913 ⟹ ENSRNOP00000008913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	61,768,740 - 61,773,297 (-)	Ensembl
Rnor_6.0 Ensembl	5	63,187,468 - 63,192,025 (-)	Ensembl

RefSeq Acc Id:

NM_001100710 ⟹ NP_001094180

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	66,564,328 - 66,568,887 (-)	NCBI
mRatBN7.2	5	61,768,738 - 61,773,297 (-)	NCBI
Rnor_6.0	5	63,187,466 - 63,192,025 (-)	NCBI
Rnor_5.0	5	67,707,025 - 67,711,584 (-)	NCBI
RGSC_v3.4	5	64,092,017 - 64,096,576 (-)	RGD
Celera	5	65,819,685 - 65,824,244 (+)	RGD

Sequence:

show sequence

CCGGGGCGGAGCTTGTAGGAGCTAGCAGAAGCTCGAGCGGAGAGCGCAGGCGCGGCTGATCTAC
CATGGCCGAAAACCTGTACCGAACCCGGTCCCGGGTTTACAGCCCATCCGTGCTGTTTCTGCAC
CCAGATATGGGTATAGGCGGTGCCGAGCGCCTAGTGCTGGACGCGGCGCTGGCGCTGCAGGAGT
ACGGCTGTCAGGTGAAGATATGGACCGCGCACTACGACCCAAACCACTGTTTCATTGAGACCCG
CGAGCTCTCGGTGCAGTGCGCAGGGGACTGGCTGCCTCGCAGCCTGGGCTGGGGCGGCCGCGGC
GCCGCCATCTGCTCCTACGTGCGCATGGTCTTTCTGGCGCTCTACGTGCTGTTTCTCTCCGGCG
AGGAGTTCGACGTGGTGGTGTGCGACCAGGTGTCTGCCTGCATCCCTGTGTTCAAACTGGCCAG
ACGGCGGAAGAGGGTCCTCTTTTACTGTCACTTCCCAGATCTGCTGCTTACTCAGAGAAATTCA
TCTCTGAAGAAGTTCTACAGGGCCCCCATCGACTGGATCGAGGAGTACACCACGGGCATGGCAG
ATCGCATCTTGGTCAACAGCCAGTACACAGCTTCCGTCTTTAAGGAAACCTTCAAGACCCTGTC
TCACAGAAATCCCGATGTGCTCTACCCATCTCTGAACATCGGCAGCTTCGACTTGGCCGTTCCT
GAAAAGATAGATGACCTAGTCCCCAAGGGGAAACAGTTCCTGTTCCTCTCCATCAACCGGTACG
AGAGGAAGAAAAACCTGCCCTTGGCCCTGAGCTCCCTGGTCCAGCTTCGCGCTCGGTTGCCGCC
TCAAGAGTGGGAGAAGGTTCATCTGTTCATGGCTGGCGGCTACGACGACAGGGTCCTGGAGAAC
GTGGAGCACTATAAGGAGTTGAAGAAAATAGTCCAAGAGTCAGATCTCGAGCGGCACGTGACCT
TCCTGCGGTCCTTCTCAGACAGACAGAAGATCTCACTCCTCCACGGCTGCTTGTGTGTGCTCTA
CACGCCCAGCAATGAGCACTTTGGCATCGTCCCTCTGGAGGCCATGTACATGCAGTGCCCGGTC
ATCGCTGTCAATTCCGGTGGGCCCTTGGAGTCTATTGTCCACAAGGTCACGGGGTTTCTGTGTG
AGCCCGACCCAGTTCACTTCTCGGAAGCCATGGAGAAGTTCATCCACAAACCATCCTTAAAGGC
AACGATGGGCCTGGCCGGAAAAGCCAGGGTGGCAGAGAAGTTTTCCGCTGATGCATTTGCAGAT
CAGCTCTACCAGTATGTCACCAAACTGGTGTAGTCGGGAGAGTGTCAGGTAGGGTCTGTATGCC
TCGTGCACTGCAGTCCCTCTTCTGGGTTGTAGAAGCACCTTTGAAACCAAAAGAGGAGGGGGAA
AAAAAGGAGCTAGAATCTAGTGCTAGTGAGATAATTTTTTTTTTTAAGTAGACTTGAGTCTTGA
GTGTGAGCCACCTGTCCACCACACCCACCTGTCATTTTCTGAAAATACTCTCAATGCTGTAATC
ATTCCGAATCACATCAGTATTGTGGAAAGTACGGTAGAAATCTGCTGCTAGCAGACGATTTTAA
TTCTATTTTCCTGGATTATTGTTCCTTTATATATAAAGGTTTAATCATCCAGTGCCTTAATTGG
CTTTAGTAGTTTAGGTCCTAACCATTGCCACAGTCAGTTGATTTGACTTCAGAGTGTAATGGGA
ACGGAGCTACTGTGGTTCCCATGCTCAGTTTACTTAAAGGGTTCTCTAGTAGCTGCTCAGAAAT
TCTTGTTGGAATTTTGGCTGGATCCACAGCAAGAGTCCTCAGTATTATTTATTTGTTTTGTTTT
GTGTTCTGTTTTGTTTTTACTGCAACTTGACAATAAAAGATGTTTGGCATTGGAAGAGAATAGA
ACATTAGGTCTGGGCCCAGCGCTCTGACTCCGTCTTGTTTAATAGTTTAACCTGAAGTCGCAAG
ACTGGGATAAACAGGAGAGCTGACATGAAGGACATCATCGCACATGTTTCGGCTTACTGTGTCA
GAACTACACGTGCTTGGCCTTATTTCTTTGAGCCTGTGGCAGAAGAGTGTATCGAGGCAGAAAG
CAGAAAGGTCCAACCTCCCTTTCTAGAAAATGTCCCTTGATGTCCTGATTCTCTTCCACTAGTC
CTCACTACTAAAGGTCCTGTCACCTCTCAGTAACACTGTGGGCCGGGAACCAAGCCTCAGGGCA
CAGGCCTTTGGGAGCTGTATTAGAGTTCTCGAGAAGAATAAACAGCACTTACAGAAGGAATTCC
CAGAAGAAGAATGACTTACAGGCTTCTGTCCAGCTAATCCAACAGTGAGCAGAAAGTCCAAAAA
TCCAGCAGTTCGGGCCATGAGGCTGGGTGTCTCGGCTGGTCTTCAGTAGACTCTGGAATCCCAA
TGACGTAGGCTCTAACGCCAGTGAAGGAATGGACTTGCCAACAAGGTGAGGCCAAGCAGGCAAA
GAGCAAAAGCTCCCTTCGTCCTGTCCTCAAGTAGACTTCTAGCAGAAGGCGTGGCCCAGACTAG
AGGTGTGTCTTCCCACCTCAAGATCAGGATTAAAGAAGATCTACTGACTTCAAATTAAGCAAAA
CTCCCTCCCAGGTGTGCCCTCTGTCATTAGATTTTAGTTCATTCAAGATGGAGTCAAGTTGACA
ACCAAGAATGGCCATCACCGGGGACACTCCACATATAAACTGTATACCAAGCTTCATATTTCAG
ACATGTTTCTTAATGTCATCCACGTCTCCAGCCCCTGTAGTGTGTATGTGTTGTATTCTCTGCA
GAATTTAGCATGCCCGTGTTTCCTGTCCTTCACATAAACGCCTTTGTGTGAAGCTTGCTTGATC
CTCCACTCCCCTCTCCAGCCCCCACCCCTGTGACACTGCCCAGTAATAACTGTTCGTTGTTTAC
CTGTTGCTTGTAAGTGCAAGTATTAAAGCAATTTGAAAGCTAAACTCACCTGTAAGACTATAAT
AAATACCTGTAATCCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094180	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05892	(Get FASTA)	NCBI Sequence Viewer
	EDL78205	(Get FASTA)	NCBI Sequence Viewer
	EDL78206	(Get FASTA)	NCBI Sequence Viewer
	EDL78207	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008913
	ENSRNOP00000008913.4

RefSeq Acc Id:

NP_001094180 ⟸ NM_001100710

- UniProtKB:

G3V6U3 (UniProtKB/TrEMBL), A6KJG8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAENLYRTRSRVYSPSVLFLHPDMGIGGAERLVLDAALALQEYGCQVKIWTAHYDPNHCFIETR
ELSVQCAGDWLPRSLGWGGRGAAICSYVRMVFLALYVLFLSGEEFDVVVCDQVSACIPVFKLAR
RRKRVLFYCHFPDLLLTQRNSSLKKFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLS
HRNPDVLYPSLNIGSFDLAVPEKIDDLVPKGKQFLFLSINRYERKKNLPLALSSLVQLRARLPP
QEWEKVHLFMAGGYDDRVLENVEHYKELKKIVQESDLERHVTFLRSFSDRQKISLLHGCLCVLY
TPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKA
TMGLAGKARVAEKFSADAFADQLYQYVTKLV

hide sequence

RefSeq Acc Id:

ENSRNOP00000008913 ⟸ ENSRNOT00000008913

Protein Domains

Glycosyl transferase family Glycosyltransferase subfamily 4-like N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6U3-F1-model_v2	AlphaFold	G3V6U3	1-415	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693721

Promoter ID:

EPDNEW_R4245

Type:

multiple initiation site

Name:

Alg2_1

Description:

ALG2, alpha-1,3/1,6-mannosyltransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	63,191,971 - 63,192,031	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309940	AgrOrtholog
BioCyc Gene	G2FUF-41378	BioCyc
Ensembl Genes	ENSRNOG00000006369	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008913	ENTREZGENE
	ENSRNOT00000008913.6	UniProtKB/TrEMBL
Gene3D-CATH	Glycogen Phosphorylase B	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7305404	IMAGE-MGC_LOAD
InterPro	ALG2	UniProtKB/TrEMBL
	Glyco_trans_1	UniProtKB/TrEMBL
	Glyco_trans_4_N	UniProtKB/TrEMBL
KEGG Report	rno:313231	UniProtKB/TrEMBL
MGC_CLONE	MGC:125129	IMAGE-MGC_LOAD
NCBI Gene	313231	ENTREZGENE
PANTHER	ALPHA-1,3/1,6-MANNOSYLTRANSFERASE ALG2	UniProtKB/TrEMBL
	PTHR45918	UniProtKB/TrEMBL
Pfam	Glyco_transf_4	UniProtKB/TrEMBL
	Glycos_transf_1	UniProtKB/TrEMBL
PhenoGen	Alg2	PhenoGen
RatGTEx	ENSRNOG00000006369	RatGTEx
Superfamily-SCOP	UDP-Glycosyltransferase/glycogen phosphorylase	UniProtKB/TrEMBL
UniProt	A6KJG8	ENTREZGENE, UniProtKB/TrEMBL
	A6KJG9_RAT	UniProtKB/TrEMBL
	G3V6U3	ENTREZGENE, UniProtKB/TrEMBL
	Q3B8P6_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-02-27	Alg2	ALG2, alpha-1,3/1,6-mannosyltransferase	Alg2	asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-02-04	Alg2	asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)	Alg2	asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Alg2	asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)	Alg2	asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Alg2	asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase)			Symbol and Name updated	1299863	APPROVED
2006-03-07	Alg2	asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase)	Alg2_predicted	asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase) (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-12	Alg2_predicted	asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)