Advanced Search (OLGA)

Gene: Psmd8 (proteasome 26S subunit, non-ATPase 8) Rattus norvegicus

Analyze

Symbol:

Psmd8

Name:

proteasome 26S subunit, non-ATPase 8

RGD ID:

1309842

Description:

Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be part of proteasome regulatory particle, lid subcomplex. Predicted to be active in nucleus. Orthologous to human PSMD8 (proteasome 26S subunit, non-ATPase 8); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

26S proteasome non-ATPase regulatory subunit 8; LOC292766; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; proteasome 26S subunit, non-ATPase, 8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmd8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmd8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmd8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psmd8 (proteasome 26S subunit, non-ATPase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSMD8 (proteasome 26S subunit, non-ATPase 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmd8 (proteasome 26S subunit, non-ATPase 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpn-12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPN12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RPN12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rpn12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rpn12R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	psmd8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,601,857 - 93,608,689 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	93,601,853 - 93,608,689 (-)	Ensembl				GRCr8
mRatBN7.2	1	84,474,377 - 84,481,209 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,474,378 - 84,481,209 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	89,885,636 - 89,892,461 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	98,345,209 - 98,352,034 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,641,483 - 91,648,308 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,116,811 - 88,123,643 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,116,812 - 88,123,643 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	89,292,312 - 89,299,144 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	84,308,348 - 84,315,180 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	78,862,047 - 78,868,833 (-)	NCBI		Celera
RGSC_v3.1	1	84,386,525 - 84,393,260 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

human immunodeficiency virus infectious disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-citrinin (ISO)

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,4-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

captan (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

elemental selenium (ISO)

ethanol (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

hydralazine (ISO)

ivermectin (ISO)

leflunomide (EXP)

lithium atom (EXP)

lithium hydride (EXP)

methidathion (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nefazodone (EXP)

nickel dichloride (EXP)

nimesulide (EXP)

ochratoxin A (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

piperonyl butoxide (EXP)

pirinixic acid (ISO)

rotenone (ISO)

Salinomycin (ISO)

sarin (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

testosterone (EXP,ISO)

tetrachloromethane (EXP,ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteasomal protein catabolic process (NAS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

proteolysis (IEA)

regulation of AMPA receptor activity (IDA)

Cellular Component

nucleus (IBA)

proteasome accessory complex (IEA,IPI,ISO)

proteasome complex (IEA,ISO,NAS)

proteasome regulatory particle (IEA)

proteasome regulatory particle, lid subcomplex (IBA)

synaptic vesicle (IDA,NAS)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	An abundance of free regulatory (19S) proteasome particles regulates neuronal synapses.	Sun C, etal., Science. 2023 May 26;380(6647):eadf2018. doi: 10.1126/science.adf2018. Epub 2023 May 26.

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:16857966	PMID:17323924	PMID:21630459	PMID:23376485	PMID:24270810

Genomics

Comparative Map Data

Psmd8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,601,857 - 93,608,689 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	93,601,853 - 93,608,689 (-)	Ensembl				GRCr8
mRatBN7.2	1	84,474,377 - 84,481,209 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,474,378 - 84,481,209 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	89,885,636 - 89,892,461 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	98,345,209 - 98,352,034 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,641,483 - 91,648,308 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,116,811 - 88,123,643 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,116,812 - 88,123,643 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	89,292,312 - 89,299,144 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	84,308,348 - 84,315,180 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	78,862,047 - 78,868,833 (-)	NCBI		Celera
RGSC_v3.1	1	84,386,525 - 84,393,260 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

PSMD8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	38,374,571 - 38,383,824 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	38,374,563 - 38,383,850 (+)	Ensembl			hg38	GRCh38
GRCh37	19	38,865,211 - 38,874,464 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	43,557,030 - 43,566,304 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	43,557,060 - 43,566,303	NCBI
Celera	19	35,667,425 - 35,676,701 (+)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	35,312,782 - 35,322,058 (+)	NCBI		HuRef
CHM1_1	19	38,865,531 - 38,874,805 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	41,176,744 - 41,185,999 (+)	NCBI		T2T-CHM13v2.0

Psmd8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	28,873,612 - 28,880,098 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	28,873,613 - 28,880,126 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	29,174,187 - 29,180,673 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	29,174,188 - 29,180,701 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	29,959,206 - 29,965,692 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	28,883,015 - 28,889,291 (-)	NCBI		MGSCv36	mm8
Celera	7	23,744,276 - 23,750,744 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	16.94	NCBI

Psmd8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	1,043,007 - 1,053,043 (-)	Ensembl
ChiLan1.0	NW_004955468	1,044,940 - 1,052,130 (-)	NCBI	ChiLan1.0	ChiLan1.0

PSMD8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	44,665,496 - 44,674,870 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	46,535,858 - 46,545,230 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	35,468,519 - 35,477,802 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	44,040,252 - 44,049,265 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	44,040,252 - 44,049,265 (+)	Ensembl			panPan2	panpan1.1

PSMD8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	114,619,478 - 114,626,082 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	114,607,058 - 114,685,985 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	114,023,172 - 114,029,776 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	115,221,181 - 115,227,786 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	115,221,180 - 115,228,314 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	114,794,138 - 114,800,742 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	114,411,732 - 114,418,338 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	115,450,356 - 115,456,964 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psmd8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	12,972,123 - 12,978,931 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936801	1,137,423 - 1,148,594 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936801	1,137,480 - 1,144,287 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMD8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	47,289,886 - 47,297,051 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	47,289,891 - 47,297,059 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	42,790,431 - 42,797,494 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMD8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	33,016,157 - 33,026,189 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	33,016,255 - 33,026,425 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	10,962,468 - 10,972,662 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmd8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	11,837,095 - 11,845,363 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	11,837,914 - 11,845,380 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psmd8
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	166,813,461 - 166,820,211 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psmd8
67 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	55
Count of miRNA genes:	48
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000027937
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat

Markers in Region

RH131189

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	45,455,871 - 45,456,065 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	84,474,545 - 84,474,730 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,116,980 - 88,117,164	NCBI	Rnor6.0
Rnor_6.0	3	47,060,798 - 47,060,991	NCBI	Rnor6.0
Rnor_5.0	3	52,168,534 - 52,168,727	UniSTS	Rnor5.0
Rnor_5.0	1	89,292,481 - 89,292,665	UniSTS	Rnor5.0
RGSC_v3.4	1	84,308,517 - 84,308,701	UniSTS	RGSC3.4
RGSC_v3.4	3	42,700,363 - 42,700,556	UniSTS	RGSC3.4
Celera	3	45,149,879 - 45,150,072	UniSTS
Celera	1	78,862,216 - 78,862,400	UniSTS
RH 3.4 Map	1	842.4	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	3	q21	UniSTS

RH124225

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	84,479,614 - 84,480,891 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,122,049 - 88,123,325	NCBI	Rnor6.0
Rnor_5.0	1	89,297,550 - 89,298,826	UniSTS	Rnor5.0
RGSC_v3.4	1	84,313,586 - 84,314,862	UniSTS	RGSC3.4
Celera	1	78,867,239 - 78,868,515	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CD371338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK844749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027937 ⟹ ENSRNOP00000027937

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	93,601,858 - 93,608,689 (-)	Ensembl
mRatBN7.2 Ensembl	1	84,474,378 - 84,481,209 (-)	Ensembl
Rnor_6.0 Ensembl	1	88,116,812 - 88,123,643 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000152995 ⟹ ENSRNOP00000105347

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	93,601,853 - 93,608,689 (-)	Ensembl

RefSeq Acc Id:

NM_001100831 ⟹ NP_001094301

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,601,857 - 93,608,689 (-)	NCBI
mRatBN7.2	1	84,474,377 - 84,481,209 (-)	NCBI
Rnor_6.0	1	88,116,811 - 88,123,643 (-)	NCBI
Rnor_5.0	1	89,292,312 - 89,299,144 (-)	NCBI
RGSC_v3.4	1	84,308,348 - 84,315,180 (-)	RGD
Celera	1	78,862,047 - 78,868,833 (-)	RGD

Sequence:

show sequence

TTTTGAATGACAACAGAGGCGGAGCTGTGGCATGTTCATTAAGGGCCGGACTGCGAAGGCGCCC
AGAGGAGAGCCGCGGCGCTCCTCCCGCCGTGGGCAGAAGCTAGCAGTCGTAGCTCCGCCTCCGG
CTTTGGGCTCCACCTCCCGGCCTCACTTCCGCCGGGAGAGCATTGCTCGGCGTCGTTGCCGTAA
ATCAGGTCGGCTGTTTGCTGCATCACGAAAGATGGCGGCCGCGGCGGCTACGGTGAACGGGACA
ACCGGCGTTTCAAGCTCCGGGCCCGCGGCCACCTCGGGCGGGATCCTACAGGCAGCGGCCGGCA
TGTACGAGCAACTCAAAGACGAGTGGAACCGGAAGAGCCCGAATCTTAGTAAATGTGGAGAAGA
GCTGGGCCGCCTGAAGTTGGTTCTGCTGGAGCTCAATTTCCTGCCAACCACGGGGACCAAACTG
ACTAAACAGCAGCTCATTCTGGCCCGTGACATTCTGGAAATCGGGGCCCAGTGGAGCATCCTAT
GCAAGGACATTCCCTCCTTCGAGCGCTACATGGCCCAGCTCAAATGCTACTACTTTGATTACAA
GGAGCAGCTTCCTGAGTCAGCCTACATGCACCAGCTCCTGGGCCTCAACCTCCTCTTCCTGCTC
TCTCAGAACCGAGTGGCTGAGTTCCACACAGAATTAGAACGATTGCCTGCCAAGGACATCCAAA
CCAATGTCTACATCAAACACCCTGTATCCCTCGAGCAATACCTCATGGAGGGTAGCTACAACAA
GGTGTTCCTGGCTAAGGGAAACATTCCCGCTGAGAGCTATACCTTCTTCATTGACATCCTGCTG
GATACTATCAGGGATGAAATTGCAGGATGCATTGAGAAGGCCTATGAGAAAATCCTTTTTGCTG
AGGCTACCCGGATCCTCTTCTTCAGCACACCCAAAAAGATGACAGACTATGCCAAGAAGCGAGG
TTGGCTGCTGGGCCCTAACAACTACTACAGCTTTGCCAGCCAGCAGCAGAAGCCAGAAGACAGC
ACCATCCCCTCCACTGAGCTGGCCAGGCAGGTCATCGAGTATGCCCGGCAGCTGGAGATGATTG
TCTGAGCCTCGGCCAAGGTGGTGGGCATGGCTGGTCCAGCAGTCTTAGCACGGGCTGGCCCTCA
ATAAAGGCAGATTAACCTCCTATGGGCCCTAGTCTCCCCAGTGGGATGGTGGAGATAAGAATTT
GGGAGTTTGGGGGCCTCTGGGCCTTCTGGGTGAGTGTTTCCTCCCAGTTGTCACTGCTCTGGGT
TTTCAGCATAGCTGCCCAGTGGCCCGCAGGAGAGCACAGGCCCTGACTGAGGTGCTCTTCTAGC
CAGCTGTGGGTGCCTTTTGGTACTGGGCAAGGGGATTGTTTTCCAGTGAAGCACCATGTGTCTC
AGTTTTTAAAAAATGTTGGCCATGGATTAAATAATTTTTAAAATGACACATGAAACTGACTTTG
TCTGTGGGCTACCATTTGAGCCTCTGTAATAAATGGTATGGACCCTGAAAAAAAAAAAAAAAAA
A

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094301	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05895	(Get FASTA)	NCBI Sequence Viewer
	EDM07842	(Get FASTA)	NCBI Sequence Viewer
	EDM07843	(Get FASTA)	NCBI Sequence Viewer
	EDM07844	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027937
	ENSRNOP00000027937.5
	ENSRNOP00000105347.1

RefSeq Acc Id:

NP_001094301 ⟸ NM_001100831

- UniProtKB:

F1LMQ3 (UniProtKB/TrEMBL), A6J9P2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFIKGRTAKAPRGEPRRSSRRGQKLAVVAPPPALGSTSRPHFRRESIARRRCRKSGRLFAASRK
MAAAAATVNGTTGVSSSGPAATSGGILQAAAGMYEQLKDEWNRKSPNLSKCGEELGRLKLVLLE
LNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMH
QLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA
ESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWLLGPNNYYS
FASQQQKPEDSTIPSTELARQVIEYARQLEMIV

hide sequence

Ensembl Acc Id:

ENSRNOP00000027937 ⟸ ENSRNOT00000027937

Ensembl Acc Id:

ENSRNOP00000105347 ⟸ ENSRNOT00000152995

Protein Domains

PCI

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LMQ3-F1-model_v2	AlphaFold	F1LMQ3	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309842	AgrOrtholog
BioCyc Gene	G2FUF-60190	BioCyc
Ensembl Genes	ENSRNOG00000037580	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027937	ENTREZGENE
	ENSRNOT00000027937.7	UniProtKB/TrEMBL
	ENSRNOT00000152995.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.990	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7321643	IMAGE-MGC_LOAD
InterPro	26S_Psome_Rpn12	UniProtKB/TrEMBL
	CSN8_PSD8_EIF3K	UniProtKB/TrEMBL
	PCI_dom	UniProtKB/TrEMBL
KEGG Report	rno:292766	UniProtKB/TrEMBL
MGC_CLONE	MGC:125165	IMAGE-MGC_LOAD
NCBI Gene	292766	ENTREZGENE
PANTHER	26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 8	UniProtKB/TrEMBL
	Nin1_C	UniProtKB/TrEMBL
Pfam	CSN8_PSD8_EIF3K	UniProtKB/TrEMBL
PhenoGen	Psmd8	PhenoGen
PROSITE	PCI	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000037580	RatGTEx
UniProt	A0ABK0LNN8_RAT	UniProtKB/TrEMBL
	A6J9P0_RAT	UniProtKB/TrEMBL
	A6J9P1_RAT	UniProtKB/TrEMBL
	A6J9P2	ENTREZGENE, UniProtKB/TrEMBL
	F1LMQ3	ENTREZGENE, UniProtKB/TrEMBL
	Q3B8P5_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Psmd8	proteasome 26S subunit, non-ATPase 8	Psmd8	proteasome (prosome, macropain) 26S subunit, non-ATPase, 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Psmd8	proteasome (prosome, macropain) 26S subunit, non-ATPase, 8	Psmd8_predicted	proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Psmd8_predicted	proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)