Advanced Search (OLGA)

Gene: Ndfip2 (Nedd4 family interacting protein 2) Rattus norvegicus

Analyze

Symbol:

Ndfip2

Name:

Nedd4 family interacting protein 2

RGD ID:

1309716

Description:

Predicted to enable WW domain binding activity. Predicted to be involved in negative regulation of protein transport; regulation of macromolecule metabolic process; and ubiquitin-dependent protein catabolic process. Predicted to be located in mitochondrion. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and perinuclear region of cytoplasm. Orthologous to human NDFIP2 (Nedd4 family interacting protein 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361089; NEDD4 family-interacting protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NDFIP2 (Nedd4 family interacting protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ndfip2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ndfip2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NDFIP2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NDFIP2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ndfip2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NDFIP2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NDFIP2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ndfip2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ndfip2 (Nedd4 family interacting protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ASCC2 (activating signal cointegrator 1 complex subunit 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NDFIP2 (Nedd4 family interacting protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ndfip2 (Nedd4 family interacting protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ndfip2 (Nedd4 family interacting protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BSD2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	Ndfip	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ndfip	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ndfip2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	88,394,548 - 88,500,881 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	88,395,032 - 88,503,600 (+)	Ensembl				GRCr8
mRatBN7.2	15	82,032,366 - 82,087,043 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	82,032,366 - 82,086,317 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	86,019,100 - 86,073,049 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	87,139,077 - 87,193,151 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	84,068,464 - 84,122,291 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	89,407,426 - 89,458,983 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	89,407,426 - 89,458,983 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	92,899,237 - 92,951,955 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	89,316,553 - 89,376,267 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	81,152,519 - 81,206,267 (+)	NCBI		Celera
RGSC_v3.1	15	89,332,169 - 89,391,325 (+)	NCBI
Cytogenetic Map	15	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

4,4'-diaminodiphenylmethane (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

clofibric acid (EXP)

clorgyline (ISO)

clotrimazole (EXP)

crocidolite asbestos (ISO)

Dibutyl phosphate (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

gentamycin (EXP)

mercury dibromide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thapsigargin (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

metal ion transport (IEA)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of protein ubiquitination (IBA)

proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO)

ubiquitin-dependent protein catabolic process (IBA)

vacuolar transport (IEA)

Cellular Component

cytoplasm (IEA,ISO)

endoplasmic reticulum (IBA,IEA,ISO)

Golgi apparatus (IBA,IEA,ISO)

membrane (IEA)

mitochondrion (IEA,ISO)

perinuclear region of cytoplasm (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

WW domain binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12761501	PMID:12796489	PMID:18776082

Genomics

Comparative Map Data

Ndfip2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	88,394,548 - 88,500,881 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	88,395,032 - 88,503,600 (+)	Ensembl				GRCr8
mRatBN7.2	15	82,032,366 - 82,087,043 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	82,032,366 - 82,086,317 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	86,019,100 - 86,073,049 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	87,139,077 - 87,193,151 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	84,068,464 - 84,122,291 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	89,407,426 - 89,458,983 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	89,407,426 - 89,458,983 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	92,899,237 - 92,951,955 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	89,316,553 - 89,376,267 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	81,152,519 - 81,206,267 (+)	NCBI		Celera
RGSC_v3.1	15	89,332,169 - 89,391,325 (+)	NCBI
Cytogenetic Map	15	q22	NCBI

NDFIP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	79,481,155 - 79,556,077 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	79,481,155 - 79,556,077 (+)	Ensembl			hg38	GRCh38
GRCh37	13	80,055,290 - 80,130,212 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	78,953,288 - 79,026,222 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	13	78,953,287 - 79,026,222	NCBI
Celera	13	60,956,330 - 61,031,747 (+)	NCBI		Celera
Cytogenetic Map	13	q31.1	NCBI
HuRef	13	60,758,152 - 60,832,800 (+)	NCBI		HuRef
CHM1_1	13	80,022,699 - 80,097,328 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	78,709,081 - 78,783,702 (+)	NCBI		T2T-CHM13v2.0

Ndfip2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	105,495,975 - 105,546,732 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	105,496,008 - 105,546,732 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	105,258,591 - 105,309,298 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	105,258,573 - 105,309,298 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	105,658,021 - 105,708,490 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	104,144,483 - 104,194,952 (+)	NCBI		MGSCv36	mm8
Celera	14	103,867,225 - 103,916,399 (+)	NCBI		Celera
Cytogenetic Map	14	E2.3	NCBI
cM Map	14	55.64	NCBI

Ndfip2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	27,979,187 - 28,051,561 (-)	Ensembl
ChiLan1.0	NW_004955404	27,981,215 - 28,051,238 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDFIP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	81,065,236 - 81,140,225 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	79,659,714 - 79,734,706 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	60,717,590 - 60,792,373 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	79,745,337 - 79,820,286 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	79,745,362 - 79,820,286 (+)	Ensembl			panPan2	panpan1.1

NDFIP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	32,723,052 - 32,789,409 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	32,704,437 - 32,787,151 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	32,524,104 - 32,589,374 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	33,049,187 - 33,114,544 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	32,990,338 - 33,116,327 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	32,708,790 - 32,774,103 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	32,753,039 - 32,818,359 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	32,820,612 - 32,885,904 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ndfip2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	126,646,403 - 126,705,987 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936511	2,063,144 - 2,124,037 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936511	2,063,630 - 2,123,214 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDFIP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	51,420,166 - 51,560,305 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	11	51,493,981 - 51,560,305 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	56,246,110 - 56,310,349 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDFIP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	58,534,898 - 58,606,555 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	58,534,973 - 58,601,812 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666046	14,783,476 - 14,855,516 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndfip2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	20,866,834 - 20,931,140 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624751	20,864,457 - 20,931,124 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ndfip2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	19,544,514 - 19,591,176 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ndfip2
842 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	155
Count of miRNA genes:	99
Interacting mature miRNAs:	126
Transcripts:	ENSRNOT00000039423
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	82194914	108192169	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	74735564	106469153	Rat
1358354	Srcrt5	Stress Responsive Cort QTL 5	3.38		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	82503470	108192169	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	82714037	106778197	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	43677244	88677244	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	43677244	88677244	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
7411646	Foco21	Food consumption QTL 21	23.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	15	84278281	108192169	Rat
631516	Gluco31	Glucose level QTL 31	7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	72716871	101425383	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	61710951	106710951	Rat
1331724	Bp223	Blood pressure QTL 223	3.53715		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	75928947	101425383	Rat
2317050	Aia24	Adjuvant induced arthritis QTL 24	2.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	59257087	104257087	Rat
2313080	Bss65	Bone structure and strength QTL 65	3.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	15	67399137	108192169	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	82194914	108192169	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	43677244	88677244	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	44806773	104695021	Rat
1576315	Schws6	Schwannoma susceptibility QTL 6		0.0069	nervous system integrity trait (VT:0010566)	post-insult time of death (CMO:0002005)	15	60213984	105213984	Rat
61477	Aia4	Adjuvant induced arthritis QTL 4	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	15	62440892	97773284	Rat
70182	BpQTLcluster12	Blood pressure QTL cluster 12	3.53		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	15	72716871	101425383	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	64571127	108192169	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	83700787	108192169	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	43677244	88677244	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	43677244	88677244	Rat

Markers in Region

RH142365

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	82,086,041 - 82,086,221 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	89,458,708 - 89,458,887	NCBI	Rnor6.0
Rnor_5.0	15	92,950,957 - 92,951,136	UniSTS	Rnor5.0
RGSC_v3.4	15	89,375,270 - 89,375,449	UniSTS	RGSC3.4
Celera	15	81,205,992 - 81,206,171	UniSTS
Cytogenetic Map	15	q22	UniSTS

BE097625

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	82,085,539 - 82,085,697 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	89,458,206 - 89,458,363	NCBI	Rnor6.0
Rnor_5.0	15	92,950,455 - 92,950,612	UniSTS	Rnor5.0
RGSC_v3.4	15	89,374,768 - 89,374,925	UniSTS	RGSC3.4
Celera	15	81,205,490 - 81,205,647	UniSTS
Cytogenetic Map	15	q22	UniSTS

BF415208

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	82,086,042 - 82,086,223 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	89,458,709 - 89,458,889	NCBI	Rnor6.0
Rnor_5.0	15	92,950,958 - 92,951,138	UniSTS	Rnor5.0
RGSC_v3.4	15	89,375,271 - 89,375,451	UniSTS	RGSC3.4
Celera	15	81,205,993 - 81,206,173	UniSTS
Cytogenetic Map	15	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BP495172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB697675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO398212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DV728397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY565248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM044778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000039423 ⟹ ENSRNOP00000032094

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	88,446,951 - 88,501,606 (+)	Ensembl
mRatBN7.2 Ensembl	15	82,032,366 - 82,086,317 (+)	Ensembl
Rnor_6.0 Ensembl	15	89,407,426 - 89,458,983 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104952 ⟹ ENSRNOP00000078524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	88,395,032 - 88,503,600 (+)	Ensembl
mRatBN7.2 Ensembl	15	82,032,977 - 82,086,246 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000168975 ⟹ ENSRNOP00000112193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	88,446,219 - 88,500,040 (+)	Ensembl

RefSeq Acc Id:

NM_001108390 ⟹ NP_001101860

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	88,446,932 - 88,500,881 (+)	NCBI
mRatBN7.2	15	82,032,366 - 82,086,317 (+)	NCBI
Rnor_6.0	15	89,407,426 - 89,458,983 (+)	NCBI
Rnor_5.0	15	92,899,237 - 92,951,955 (+)	NCBI
RGSC_v3.4	15	89,316,553 - 89,376,267 (+)	RGD
Celera	15	81,152,519 - 81,206,267 (+)	NCBI

Sequence:

show sequence

CGCCCACTCCCGACCGGCTGACAACCTAGAGGGCTCCCCGGGACTTGCCTGACTTTTCCATCTC
CTCCCACCTAGGGACACCTTCGGAGCGGGGCCTCCGATGGGACGCCGGCGGAGCCAGAGAGCAT
GCGCGTCCGCCCCGAGCATGCTCAGTAGCGCGCGCGGCTCCCCGGAGCTCCGACGCCGATCGGC
GAGCGAAGCGGAGGTCTCCGCCGCAGCCGAGGGAGCGACAGGAAGTGAAGTGGCCCCGCCGGGC
GACCGCGGCGGCAGAACGCGAGGCAGCGGAAGGGGCTCTGCGGCGACGGCGTCGTCGACCGGGG
AGGCCGAGGGAGCTGAGCGCGGGGCAGACACGCCCGCTCGGAAGCCGGACCCCGAGGCGGGCAG
GATGGATCACCACCAGCTGGGGACTGGCCGCTACCAGGTGCTTCACAACGAGGACGATAACTCA
GAATCATCTGCCCCAGAGCAGCCGTCAGCTTCCAGCTCAGCAGCACAGCCTGTGGAGGCTGCTG
CCTCAGCGCCAGCCCTGGACGCCGACTCTTCTCCTCCACCTTACAGCAGCATCACTGTGGACGG
TCCCACAACTTCAGATGCTGACGTGTACAGTGAGTTTTACCCTGTGCCCCCTCCGTACAGCGTC
GCTACCTCTCTCCCGACATACGATGAGGCTGAAAAGGCTAAAGCTGCTGCCCTGGCCGCTGCAG
CAGCAGACGCACCTCAAAGAAACCAAGAGGAAGAGTGTCCACCCAGGGATGACTTCAGTGATGT
GGAGCAGCTCAGAGTAGGCAATGATGGCATTTTCATGCTGGCCTTTTTCATGGCATTCATATTC
AACTGGCTTGGATTCTGCTTATCCTTCTGTATCACCAATACCATAGCTGGAAGATACGGTGCTA
TCTGTGGATTTGGCCTCTCACTGATCAAATGGATCCTTATTGTCAGGTTTTCGGACTATTTTAC
TGGCTATTTCAATGGACAATATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTC
TTCAGAGGATTTGTTAATTACCTAAAGGTCAGAAACATGTCTGAAAGTATGGCAGCTGCGCACA
GAACAAGATACTTCTTCCTTCTCTAGAGGTGGCGTCAACCCAACATTCCTCTCTTACACCAATG
TGAAATGTCCAAGTCGTCTGTAAACCTACAACTTCGCTAAGATAGACTACTGAGCGCAGAAGCA
GATGTAGTGAGGGGTGGAGCGTCGGAATTAAATGACAGGGTGGTTTATGCTACAAGCCATGTCT
GTTCATTCCTTAATTCTCTTTGGTATCTCAATTTATTTTGCACATTTGCATATGTGCCTGTTTA
AAGGGTATGCATATACTTGAAAGAATCTGTAAAGTTGTAGCAGCAAAGTCCAGTCCTACTTGGT
TAATCAGTGTTTGATACAATTGGAAGAGTTGAGTACTAAACAGTCTTCCAGCATGTAAATGCTT
CTGACTTGACCATTAGCGTAATAAAAATTACATTATTAATCTTGTCAAATGCTTTAGTTTCTGG
CTCTTAGATTCACCTAGTAATTCCACACACGAAATATTCTTTGTTATATATGATGTTTATTAAA
ACTTGCAGTATGATTATTAGAAAGAATTTGTCAGATTTTTAAATATGATATTATTTAGGAAATC
TGTAAATAACCATGCATAAGTTGCTCTTTACATTCTTTTCTTAAATTGTGTCTAGATATCTTTT
CATTAATTTTAAATTAAGTAAACTAAATACATAGAAATAAACTTCATTAAAGATGGAGTGGTTT
AGGGTGAACTTTAAGAAAGTATGAGTATACCAAATGCTGTTTAAAGAACAAGTTAGGGCCACAC
CAGTTTTAGGGGTTTTCAGATGAGAACCTTACATTTTAAGATTACTCACCTTACAATTCTTACA
AGAAGAGATTGCTTTAGACCTTATATTTATTACATCTAAGACAATTTAAAAAATTAATTTACCA
AATATATTCTCATTTGCATTTGTCTTTCCAAAAGCCAATAAAAGTATCTTTCAGTATTACTGTA
ATCATTTTTTTCTTTAAATGTTTACTCTGTTAAGCTTAGCAAATAAAATCTTGTTCTGTTAA

hide sequence

RefSeq Acc Id:

XM_063274468 ⟹ XP_063130538

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	88,394,548 - 88,500,881 (+)	NCBI

RefSeq Acc Id:

XM_063274469 ⟹ XP_063130539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	88,394,559 - 88,500,881 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101860	(Get FASTA)	NCBI Sequence Viewer
	XP_063130538	(Get FASTA)	NCBI Sequence Viewer
	XP_063130539	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02479	(Get FASTA)	NCBI Sequence Viewer
	EDM02480	(Get FASTA)	NCBI Sequence Viewer
	EDM02481	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032094
	ENSRNOP00000032094.6
	ENSRNOP00000078524
	ENSRNOP00000078524.2
	ENSRNOP00000112193.1

RefSeq Acc Id:

NP_001101860 ⟸ NM_001108390

- UniProtKB:

F1M1W4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGRRRSQRACASAPSMLSSARGSPELRRRSASEAEVSAAAEGATGSEVAPPGDRGGRTRGSGRG
SAATASSTGEAEGAERGADTPARKPDPEAGRMDHHQLGTGRYQVLHNEDDNSESSAPEQPSASS
SAAQPVEAAASAPALDADSSPPPYSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEK
AKAAALAAAAADAPQRNQEEECPPRDDFSDVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCIT
NTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRN
MSESMAAAHRTRYFFLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000032094 ⟸ ENSRNOT00000039423

Ensembl Acc Id:

ENSRNOP00000078524 ⟸ ENSRNOT00000104952

RefSeq Acc Id:	XP_063130538 ⟸ XM_063274468
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063130539 ⟸ XM_063274469
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000112193 ⟸ ENSRNOT00000168975

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M1W4-F1-model_v2	AlphaFold	F1M1W4	1-337	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309716	AgrOrtholog
BioCyc Gene	G2FUF-12623	BioCyc
Ensembl Genes	ENSRNOG00000024022	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039423	ENTREZGENE
	ENSRNOT00000039423.7	UniProtKB/TrEMBL
	ENSRNOT00000104952	ENTREZGENE
	ENSRNOT00000104952.2	UniProtKB/TrEMBL
	ENSRNOT00000168975.1	UniProtKB/TrEMBL
InterPro	DUF2370	UniProtKB/TrEMBL
KEGG Report	rno:361089	UniProtKB/TrEMBL
NCBI Gene	361089	ENTREZGENE
PANTHER	NEDD4 FAMILY-INTERACTING PROTEIN 2	UniProtKB/TrEMBL
	PTHR13396	UniProtKB/TrEMBL
Pfam	DUF2370	UniProtKB/TrEMBL
PhenoGen	Ndfip2	PhenoGen
RatGTEx	ENSRNOG00000024022	RatGTEx
UniProt	A0A8I6G338_RAT	UniProtKB/TrEMBL
	A0ABK0M2Q5_RAT	UniProtKB/TrEMBL
	F1M1W4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Ndfip2	Nedd4 family interacting protein 2	Ndfip2_predicted	Nedd4 family interacting protein 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ndfip2_predicted	Nedd4 family interacting protein 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message