Symbol:
Ndfip2
Name:
Nedd4 family interacting protein 2
RGD ID:
1309716
Description:
Predicted to enable WW domain binding activity. Predicted to be involved in several processes, including negative regulation of transport; positive regulation of canonical NF-kappaB signal transduction; and regulation of macromolecule metabolic process. Predicted to be located in mitochondrion. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and perinuclear region of cytoplasm. Orthologous to human NDFIP2 (Nedd4 family interacting protein 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361089; NEDD4 family-interacting protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 88,394,548 - 88,500,881 (+) NCBI GRCr8 mRatBN7.2 15 82,032,366 - 82,087,043 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 82,032,366 - 82,086,317 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 86,019,100 - 86,073,049 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 87,139,077 - 87,193,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 84,068,464 - 84,122,291 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 89,407,426 - 89,458,983 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 89,407,426 - 89,458,983 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 92,899,237 - 92,951,955 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 89,316,553 - 89,376,267 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 89,332,169 - 89,391,325 (+) NCBI Celera 15 81,152,519 - 81,206,267 (+) NCBI Celera Cytogenetic Map 15 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndfip2 Rat 1,2-dimethylhydrazine decreases expression ISO Ndfip2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NDFIP2 mRNA CTD PMID:22206623 Ndfip2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of NDFIP2 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of NDFIP2 mRNA CTD PMID:26496021 and PMID:32741896 Ndfip2 Rat 17beta-estradiol decreases expression ISO Ndfip2 (Mus musculus) 6480464 Estradiol results in decreased expression of NDFIP2 mRNA CTD PMID:39298647 Ndfip2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of NDFIP2 mRNA CTD PMID:32741896 Ndfip2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO NDFIP2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of NDFIP2 mRNA CTD PMID:29581250 Ndfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDFIP2 mRNA CTD PMID:21215274 Ndfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NDFIP2 mRNA CTD PMID:34747641 Ndfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ndfip2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NDFIP2 mRNA CTD PMID:21570461 Ndfip2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO NDFIP2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of NDFIP2 mRNA CTD PMID:22298810 Ndfip2 Rat 2-methylcholine affects expression ISO NDFIP2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of NDFIP2 mRNA CTD PMID:21179406 Ndfip2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Ndfip2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of NDFIP2 mRNA CTD PMID:18648102 Ndfip2 Rat 5-aza-2'-deoxycytidine affects expression ISO NDFIP2 (Homo sapiens) 6480464 Decitabine affects the expression of NDFIP2 mRNA CTD PMID:23300844 Ndfip2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NDFIP2 mRNA CTD PMID:30047161 Ndfip2 Rat all-trans-retinoic acid increases expression ISO NDFIP2 (Homo sapiens) 6480464 Tretinoin results in increased expression of NDFIP2 mRNA CTD PMID:21934132 Ndfip2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NDFIP2 mRNA CTD PMID:30047161 Ndfip2 Rat antirheumatic drug increases expression ISO NDFIP2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NDFIP2 mRNA CTD PMID:24449571 Ndfip2 Rat benzo[a]pyrene multiple interactions ISO Ndfip2 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to NDFIP2 promoter] CTD PMID:19654925 Ndfip2 Rat benzo[a]pyrene diol epoxide I increases expression ISO NDFIP2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Ndfip2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of NDFIP2 mRNA CTD PMID:26496021 Ndfip2 Rat bisphenol A increases expression ISO Ndfip2 (Mus musculus) 6480464 bisphenol A results in increased expression of NDFIP2 mRNA CTD PMID:33221593 Ndfip2 Rat bisphenol A decreases expression ISO NDFIP2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NDFIP2 mRNA CTD PMID:29275510 Ndfip2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NDFIP2 gene CTD PMID:28505145 Ndfip2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDFIP2 mRNA CTD PMID:25181051 Ndfip2 Rat bisphenol F increases expression ISO Ndfip2 (Mus musculus) 6480464 bisphenol F results in increased expression of NDFIP2 mRNA CTD PMID:38685157 Ndfip2 Rat cadmium atom multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDFIP2 mRNA CTD PMID:35301059 Ndfip2 Rat cadmium dichloride multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDFIP2 mRNA CTD PMID:35301059 Ndfip2 Rat cisplatin affects expression ISO NDFIP2 (Homo sapiens) 6480464 Cisplatin affects the expression of NDFIP2 mRNA CTD PMID:23300844 Ndfip2 Rat cisplatin increases expression ISO NDFIP2 (Homo sapiens) 6480464 Cisplatin results in increased expression of NDFIP2 mRNA CTD PMID:27594783 Ndfip2 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NDFIP2 mRNA CTD PMID:17602206 Ndfip2 Rat clorgyline increases expression ISO NDFIP2 (Homo sapiens) 6480464 Clorgyline results in increased expression of NDFIP2 mRNA CTD PMID:19691856 Ndfip2 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of NDFIP2 mRNA CTD PMID:30047161 Ndfip2 Rat crocidolite asbestos decreases expression ISO Ndfip2 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of NDFIP2 mRNA CTD PMID:29279043 Ndfip2 Rat Dibutyl phosphate affects expression ISO NDFIP2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NDFIP2 mRNA CTD PMID:37042841 Ndfip2 Rat diuron decreases expression ISO NDFIP2 (Homo sapiens) 6480464 Diuron results in decreased expression of NDFIP2 mRNA CTD PMID:35967413 Ndfip2 Rat dorsomorphin multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ndfip2 Rat doxorubicin decreases expression ISO NDFIP2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NDFIP2 mRNA CTD PMID:29803840 Ndfip2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NDFIP2 mRNA CTD PMID:29391264 Ndfip2 Rat folic acid decreases expression ISO Ndfip2 (Mus musculus) 6480464 Folic Acid results in decreased expression of NDFIP2 mRNA CTD PMID:25629700 Ndfip2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NDFIP2 mRNA CTD PMID:33387578 Ndfip2 Rat mercury dibromide increases expression ISO NDFIP2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of NDFIP2 mRNA CTD PMID:26272509 Ndfip2 Rat mercury dibromide multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NDFIP2 mRNA CTD PMID:27188386 Ndfip2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NDFIP2 mRNA CTD PMID:30047161 Ndfip2 Rat methylmercury chloride decreases expression ISO NDFIP2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NDFIP2 mRNA CTD PMID:28001369 Ndfip2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NDFIP2 mRNA CTD PMID:17602206 Ndfip2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of NDFIP2 mRNA CTD PMID:24136188 Ndfip2 Rat paracetamol affects expression ISO Ndfip2 (Mus musculus) 6480464 Acetaminophen affects the expression of NDFIP2 mRNA CTD PMID:17562736 Ndfip2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NDFIP2 mRNA CTD PMID:33387578 Ndfip2 Rat paracetamol increases expression ISO NDFIP2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NDFIP2 mRNA CTD PMID:25704631 Ndfip2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ndfip2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of NDFIP2 mRNA CTD PMID:36331819 Ndfip2 Rat phenobarbital increases expression ISO Ndfip2 (Mus musculus) 6480464 Phenobarbital results in increased expression of NDFIP2 mRNA CTD PMID:19270015 Ndfip2 Rat phenylmercury acetate increases expression ISO NDFIP2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of NDFIP2 mRNA CTD PMID:26272509 Ndfip2 Rat phenylmercury acetate multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NDFIP2 mRNA CTD PMID:27188386 Ndfip2 Rat pirinixic acid increases expression ISO Ndfip2 (Mus musculus) 6480464 pirinixic acid results in increased expression of NDFIP2 mRNA CTD PMID:23811191 Ndfip2 Rat quercetin decreases expression ISO NDFIP2 (Homo sapiens) 6480464 Quercetin results in decreased expression of NDFIP2 mRNA CTD PMID:21632981 Ndfip2 Rat SB 431542 multiple interactions ISO NDFIP2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ndfip2 Rat sodium arsenite decreases expression ISO NDFIP2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NDFIP2 mRNA CTD PMID:16507463 Ndfip2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NDFIP2 mRNA CTD PMID:30047161 Ndfip2 Rat temozolomide decreases expression ISO NDFIP2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of NDFIP2 mRNA CTD PMID:31758290 Ndfip2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of NDFIP2 mRNA CTD PMID:32741896 Ndfip2 Rat tetrachloromethane increases expression ISO Ndfip2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NDFIP2 mRNA CTD PMID:27339419 and PMID:31919559 Ndfip2 Rat thapsigargin increases expression ISO NDFIP2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of NDFIP2 mRNA CTD PMID:29453283 Ndfip2 Rat trichostatin A increases expression ISO NDFIP2 (Homo sapiens) 6480464 trichostatin A results in increased expression of NDFIP2 mRNA CTD PMID:24935251 Ndfip2 Rat trichostatin A affects expression ISO NDFIP2 (Homo sapiens) 6480464 trichostatin A affects the expression of NDFIP2 mRNA CTD PMID:28542535 Ndfip2 Rat triphenyl phosphate affects expression ISO NDFIP2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDFIP2 mRNA CTD PMID:37042841 Ndfip2 Rat urethane increases expression ISO NDFIP2 (Homo sapiens) 6480464 Urethane results in increased expression of NDFIP2 mRNA CTD PMID:28818685 Ndfip2 Rat valproic acid affects expression ISO NDFIP2 (Homo sapiens) 6480464 Valproic Acid affects the expression of NDFIP2 mRNA CTD PMID:25979313 Ndfip2 Rat valproic acid increases expression ISO NDFIP2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NDFIP2 mRNA CTD PMID:23179753 more ...
Ndfip2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 88,394,548 - 88,500,881 (+) NCBI GRCr8 mRatBN7.2 15 82,032,366 - 82,087,043 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 82,032,366 - 82,086,317 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 86,019,100 - 86,073,049 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 87,139,077 - 87,193,151 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 84,068,464 - 84,122,291 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 89,407,426 - 89,458,983 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 89,407,426 - 89,458,983 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 92,899,237 - 92,951,955 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 89,316,553 - 89,376,267 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 89,332,169 - 89,391,325 (+) NCBI Celera 15 81,152,519 - 81,206,267 (+) NCBI Celera Cytogenetic Map 15 q22 NCBI
NDFIP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 79,481,155 - 79,556,077 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 79,481,155 - 79,556,077 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 80,055,290 - 80,130,212 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 78,953,288 - 79,026,222 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 78,953,287 - 79,026,222 NCBI Celera 13 60,956,330 - 61,031,747 (+) NCBI Celera Cytogenetic Map 13 q31.1 NCBI HuRef 13 60,758,152 - 60,832,800 (+) NCBI HuRef CHM1_1 13 80,022,699 - 80,097,328 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 78,709,081 - 78,783,702 (+) NCBI T2T-CHM13v2.0
Ndfip2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 105,495,975 - 105,546,732 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 105,496,008 - 105,546,732 (+) Ensembl GRCm39 Ensembl GRCm38 14 105,258,591 - 105,309,298 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 105,258,573 - 105,309,298 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 105,658,021 - 105,708,490 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 104,144,483 - 104,194,952 (+) NCBI MGSCv36 mm8 Celera 14 103,867,225 - 103,916,399 (+) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 55.64 NCBI
Ndfip2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 27,979,187 - 28,051,561 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 27,981,215 - 28,051,238 (-) NCBI ChiLan1.0 ChiLan1.0
NDFIP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 81,065,236 - 81,140,225 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 79,659,714 - 79,734,706 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 60,717,590 - 60,792,373 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 79,745,337 - 79,820,286 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 79,745,362 - 79,820,286 (+) Ensembl panpan1.1 panPan2
NDFIP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 32,723,052 - 32,789,409 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 32,704,437 - 32,787,151 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 32,524,104 - 32,589,374 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 33,049,187 - 33,114,544 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 32,990,338 - 33,116,327 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 32,708,790 - 32,774,103 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 32,753,039 - 32,818,359 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 32,820,612 - 32,885,904 (+) NCBI UU_Cfam_GSD_1.0
Ndfip2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 126,646,403 - 126,705,987 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 2,063,144 - 2,124,037 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 2,063,630 - 2,123,214 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDFIP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 51,420,166 - 51,560,305 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 51,493,981 - 51,560,305 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 56,246,110 - 56,310,349 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NDFIP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 58,534,898 - 58,606,555 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 58,534,973 - 58,601,812 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 14,783,476 - 14,855,516 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndfip2
.
Predicted Target Of
Count of predictions: 155 Count of miRNA genes: 99 Interacting mature miRNAs: 126 Transcripts: ENSRNOT00000039423 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
RH142365
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 82,086,041 - 82,086,221 (+) MAPPER mRatBN7.2 Rnor_6.0 15 89,458,708 - 89,458,887 NCBI Rnor6.0 Rnor_5.0 15 92,950,957 - 92,951,136 UniSTS Rnor5.0 RGSC_v3.4 15 89,375,270 - 89,375,449 UniSTS RGSC3.4 Celera 15 81,205,992 - 81,206,171 UniSTS Cytogenetic Map 15 q22 UniSTS
BE097625
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 82,085,539 - 82,085,697 (+) MAPPER mRatBN7.2 Rnor_6.0 15 89,458,206 - 89,458,363 NCBI Rnor6.0 Rnor_5.0 15 92,950,455 - 92,950,612 UniSTS Rnor5.0 RGSC_v3.4 15 89,374,768 - 89,374,925 UniSTS RGSC3.4 Celera 15 81,205,490 - 81,205,647 UniSTS Cytogenetic Map 15 q22 UniSTS
BF415208
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 82,086,042 - 82,086,223 (+) MAPPER mRatBN7.2 Rnor_6.0 15 89,458,709 - 89,458,889 NCBI Rnor6.0 Rnor_5.0 15 92,950,958 - 92,951,138 UniSTS Rnor5.0 RGSC_v3.4 15 89,375,271 - 89,375,451 UniSTS RGSC3.4 Celera 15 81,205,993 - 81,206,173 UniSTS Cytogenetic Map 15 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039423 ⟹ ENSRNOP00000032094
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 82,032,366 - 82,086,317 (+) Ensembl Rnor_6.0 Ensembl 15 89,407,426 - 89,458,983 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104952 ⟹ ENSRNOP00000078524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 82,032,977 - 82,086,246 (+) Ensembl
RefSeq Acc Id:
NM_001108390 ⟹ NP_001101860
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 88,446,932 - 88,500,881 (+) NCBI mRatBN7.2 15 82,032,366 - 82,086,317 (+) NCBI Rnor_6.0 15 89,407,426 - 89,458,983 (+) NCBI Rnor_5.0 15 92,899,237 - 92,951,955 (+) NCBI RGSC_v3.4 15 89,316,553 - 89,376,267 (+) RGD Celera 15 81,152,519 - 81,206,267 (+) NCBI
Sequence:
CGCCCACTCCCGACCGGCTGACAACCTAGAGGGCTCCCCGGGACTTGCCTGACTTTTCCATCTCCTCCCACCTAGGGACACCTTCGGAGCGGGGCCTCCGATGGGACGCCGGCGGAGCCAGAGAGCAT
hide sequence
RefSeq Acc Id:
XM_063274468 ⟹ XP_063130538
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 88,394,548 - 88,500,881 (+) NCBI
RefSeq Acc Id:
XM_063274469 ⟹ XP_063130539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 88,394,559 - 88,500,881 (+) NCBI
RefSeq Acc Id:
NP_001101860 ⟸ NM_001108390
- UniProtKB:
F1M1W4 (UniProtKB/TrEMBL)
- Sequence:
MGRRRSQRACASAPSMLSSARGSPELRRRSASEAEVSAAAEGATGSEVAPPGDRGGRTRGSGRGSAATASSTGEAEGAERGADTPARKPDPEAGRMDHHQLGTGRYQVLHNEDDNSESSAPEQPSASS
hide sequence
Ensembl Acc Id:
ENSRNOP00000032094 ⟸ ENSRNOT00000039423
Ensembl Acc Id:
ENSRNOP00000078524 ⟸ ENSRNOT00000104952
RefSeq Acc Id:
XP_063130538 ⟸ XM_063274468
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063130539 ⟸ XM_063274469
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Ndfip2
Nedd4 family interacting protein 2
Ndfip2_predicted
Nedd4 family interacting protein 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ndfip2_predicted
Nedd4 family interacting protein 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
