Tmem209 (transmembrane protein 209)

Advanced Search (OLGA)

Gene: Tmem209 (transmembrane protein 209) Rattus norvegicus

Analyze

Symbol:

Tmem209

Name:

transmembrane protein 209

RGD ID:

1309682

Description:

Predicted to be located in Golgi apparatus and nuclear envelope. Predicted to be active in membrane. Orthologous to human TMEM209 (transmembrane protein 209); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC312200; RGD1309682; similar to hypothetical protein FLJ14803

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM209 (transmembrane protein 209)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tmem209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem209 (transmembrane protein 209)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tmem209 (transmembrane protein 209)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMEM209 (transmembrane protein 209)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem209 (transmembrane protein 209)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	B0464.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6479	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem209	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,070,346 - 60,096,039 (-)	NCBI		GRCr8
mRatBN7.2	4	59,102,943 - 59,128,636 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,101,550 - 59,128,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	64,081,062 - 64,106,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	59,997,249 - 60,022,895 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,399,166 - 58,424,812 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,796,337 - 57,823,283 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,796,338 - 57,823,295 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	57,558,246 - 57,585,262 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	57,392,636 - 57,419,582 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	57,668,766 - 57,695,712 (-)	NCBI
Celera	4	54,200,737 - 54,227,675 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

beta-carotene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diethyl maleate (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

methapyrilene (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

propiconazole (ISO)

SB 431542 (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

sunitinib (ISO)

testosterone (ISO)

thapsigargin (EXP,ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

Golgi apparatus (IEA)

membrane (IBA,IEA)

nuclear envelope (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Tmem209
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,070,346 - 60,096,039 (-)	NCBI		GRCr8
mRatBN7.2	4	59,102,943 - 59,128,636 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,101,550 - 59,128,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	64,081,062 - 64,106,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	59,997,249 - 60,022,895 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,399,166 - 58,424,812 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,796,337 - 57,823,283 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,796,338 - 57,823,295 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	57,558,246 - 57,585,262 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	57,392,636 - 57,419,582 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	57,668,766 - 57,695,712 (-)	NCBI
Celera	4	54,200,737 - 54,227,675 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

TMEM209
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	130,164,713 - 130,205,406 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	130,164,713 - 130,207,770 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	129,804,553 - 129,845,246 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	129,591,791 - 129,632,574 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	124,600,320 - 124,641,097 (-)	NCBI		Celera
Cytogenetic Map	7	q32.2	NCBI
HuRef	7	124,166,950 - 124,207,734 (-)	NCBI		HuRef
CHM1_1	7	129,738,166 - 129,778,916 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	131,478,118 - 131,518,796 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	129,189,927 - 129,230,704 (-)	NCBI

Tmem209
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	30,480,806 - 30,509,786 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	30,479,052 - 30,509,782 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	30,481,022 - 30,509,787 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	30,479,053 - 30,509,783 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	30,431,233 - 30,459,706 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	30,431,243 - 30,459,716 (-)	NCBI		MGSCv36	mm8
Celera	6	30,491,273 - 30,519,747 (-)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.52	NCBI

Tmem209
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	10,822,157 - 10,859,821 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	10,822,157 - 10,859,415 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMEM209
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	166,986,080 - 167,027,798 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	18,996,324 - 19,038,042 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	122,131,462 - 122,172,325 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	134,648,846 - 134,689,902 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	134,648,846 - 134,689,897 (-)	Ensembl	panpan1.1		panPan2

TMEM209
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	6,696,659 - 6,725,914 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	6,697,471 - 6,738,206 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	6,382,484 - 6,412,713 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	6,457,092 - 6,487,334 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	6,458,015 - 6,486,703 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	6,662,304 - 6,692,540 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	6,406,985 - 6,437,204 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	6,550,631 - 6,580,846 (+)	NCBI		UU_Cfam_GSD_1.0

Tmem209
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	24,892,252 - 24,925,963 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936579	5,024,817 - 5,056,963 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936579	5,024,866 - 5,057,319 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM209
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	18,615,258 - 18,644,708 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	18,615,258 - 18,644,708 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	19,652,248 - 19,682,015 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM209
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	98,801,010 - 98,842,709 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	98,800,934 - 98,842,323 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	4,562,076 - 4,603,070 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem209
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	6,070,879 - 6,101,785 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	6,071,683 - 6,100,820 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem209
113 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	128
Count of miRNA genes:	108
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000032772
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat

Markers in Region

BF396254

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,114,807 - 59,114,948 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,809,488 - 57,809,628	NCBI	Rnor6.0
Rnor_5.0	4	57,571,397 - 57,571,537	UniSTS	Rnor5.0
RGSC_v3.4	4	57,405,787 - 57,405,927	UniSTS	RGSC3.4
Celera	4	54,213,880 - 54,214,020	UniSTS
RH 3.4 Map	4	346.02	UniSTS
Cytogenetic Map	4	q22	UniSTS

BF397637

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,103,102 - 59,103,241 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,797,784 - 57,797,922	NCBI	Rnor6.0
Rnor_5.0	4	57,559,693 - 57,559,831	UniSTS	Rnor5.0
RGSC_v3.4	4	57,394,083 - 57,394,221	UniSTS	RGSC3.4
Celera	4	54,202,184 - 54,202,322	UniSTS
RH 3.4 Map	4	348.11	UniSTS
Cytogenetic Map	4	q22	UniSTS

BQ200526

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,105,427 - 59,105,587 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,800,109 - 57,800,268	NCBI	Rnor6.0
Rnor_5.0	4	57,562,018 - 57,562,177	UniSTS	Rnor5.0
RGSC_v3.4	4	57,396,408 - 57,396,567	UniSTS	RGSC3.4
Celera	4	54,204,509 - 54,204,668	UniSTS
RH 3.4 Map	4	350.5	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001395029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001395030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006236202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079399	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032772 ⟹ ENSRNOP00000031535

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,101,550 - 59,128,570 (-)	Ensembl
Rnor_6.0 Ensembl	4	57,796,338 - 57,823,283 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091255 ⟹ ENSRNOP00000073944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,102,924 - 59,128,592 (-)	Ensembl
Rnor_6.0 Ensembl	4	57,798,012 - 57,823,295 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108938 ⟹ ENSRNOP00000079323

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,101,765 - 59,128,630 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116575 ⟹ ENSRNOP00000084579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,102,935 - 59,128,627 (-)	Ensembl

RefSeq Acc Id:

NM_001014055 ⟹ NP_001014077

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,070,346 - 60,096,039 (-)	NCBI
mRatBN7.2	4	59,102,943 - 59,128,636 (-)	NCBI
Rnor_6.0	4	57,796,337 - 57,823,283 (-)	NCBI
Rnor_5.0	4	57,558,246 - 57,585,262 (-)	NCBI
RGSC_v3.4	4	57,392,636 - 57,419,582 (-)	RGD
Celera	4	54,200,737 - 54,227,675 (-)	RGD

Sequence:

show sequence

CGCGAGTACACGGCTTCCTGCTGAAGAACATGATGCAAGGAGAAGTAAGCCCCAGTCCTTCCCT
TATTGATAGAACCATCAGGATGAGAAAGGAAACAGAATCTAGGAAAGTGGTTTTAGCCTGGGGA
CTTCTAAATGTATCCATGGCTGGAATGATATATACTGAAATGACTGGAAAGTTAATTAGTACAT
ATTATAATGTGACATACTGGCCCCTCTGGTATATTGAACTCGCCCTCGCCTCACTCTTCAGTCT
TAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACTGTAGCACCTACAAGTCTGGTAGTT
AGCCCTGGACAGCAAACCTTGTTAGGGCTGAAACCAGCTGTGGTGCAGACCACACCTCCCCGTG
ATTTGGCGGCCACCCAAATCTCTCCGTCCCCTCCTTCCCCTTCGATTCAAGGTCAGAGTGTGTT
GAGTTATAGCCCATCGCGCTCGCCCAGTACCAGTCCCAAGTTTGCCACCAGCTGCATGACTGGG
TATAGTCCTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCGTACAGCCCTGCTGTGACTT
ACTCGCCTGTCAGTGGCTATAGTAAGTTGGCGAGCTTTAGTCTGTCTCCTTCTTCTCCCTACCC
TACCACCGTGGGCCCTGTGGAGAGCAGTGGATTGAGAGCTCGCTACCGTTCTCCACCCACGGCC
TATAACTCACCCACCGACAAGGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTA
GAAGTGAGGAAGAGAAACAGCATAGAGTGAAGCTGGGGAGCCCAGACTCTACCTCTCCATCTAC
CAGCCCTACCTTCTGGAATTACAGTCGTTCTGTGGGGGACTATGCACAAACCTTAAAGAAGTTT
CAGTATCAGCTTGCCTGTAGATCTCAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTT
CTAAGCAAGCTGCCGAAGAGGTTTGGGCAAGAGTGACTATGAATAGACAGCTTCTTGATCACAT
GGATTCATGGACAGCCAAATTTAGAAATTGGATCAGTGAGACAATATTAGTGCCACTTGTGCAA
GAGATTGAGTCTGTCAGCACCCAGATGAGACGGATGGGCTGTCCAGAGCTACAAATAGGAGAGG
CGAGTGTTACCAGCTTGAAACAAGCTGCCCTGGTCAAAGCTCCTCTCATCCCAACTCTGAATGC
AATTGTGCAGTATTTAGACCTAACACCAAATCAGGAGTACTTGTTTGAAAGAATCAAAGAACTT
TCTCAGGGAGGCTGTATGAGCTCATTCCGATGGAACCGAGGTGGAGACTTCAAAGGACGCCGCT
GGGACACAGACCTGCCCACTGACTCTGCTATCATCATGCATGTGTTTTGCACCTACCTTGATTC
CAGATTACCTCCACACCCTAAGTACCCTGACGGTAAAACATTCACTTCTCAGCACTTTGTTCAG
ACACCAAATAAACCAGATGTTACGAATGAAAATGTGTTCTGTGTTTATCAGAGTGCTATCAACC
CTCCACACTATGAGCTAATCTATCAGCGGCACGTCTACAGTCTTCCAAAGGGCAGAAATAACAT
GTTTCATACGTTGTTGATGTTCCTGTACATCATAAAGACCAAAGAGTCAGGAATGCTTGGGAGA
GTTAATCTTGGGCTGTCTGGTGTGAATATTTTATGGATTTTTGGAGAGTAGTCCATCGTTTAAT
TCCAAACATTTGGACTTTGATTGTAATTGGCCTGGAAGGAGTTGAAGCTAAGTATGTCCGCGAG
TTGAATCCAGGGTGCAGCTTACAGTGTCCCACTGAGCTACAGCCCCAGCCTCCAATTCAGCAGT
CTGTTGTATTAAAGCGAATCAGTGTCTACTGATACCACAGATCCTCCTAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001395029 ⟹ NP_001381958

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,070,346 - 60,095,980 (-)	NCBI
mRatBN7.2	4	59,102,943 - 59,128,577 (-)	NCBI

RefSeq Acc Id:

NM_001395030 ⟹ NP_001381959

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,070,346 - 60,096,039 (-)	NCBI
mRatBN7.2	4	59,102,943 - 59,128,636 (-)	NCBI

RefSeq Acc Id:

XM_039107516 ⟹ XP_038963444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,070,346 - 60,096,022 (-)	NCBI
mRatBN7.2	4	59,102,943 - 59,127,726 (-)	NCBI

RefSeq Acc Id:

XM_063285986 ⟹ XP_063142056

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,070,346 - 60,095,979 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014077	(Get FASTA)	NCBI Sequence Viewer
	NP_001381958	(Get FASTA)	NCBI Sequence Viewer
	NP_001381959	(Get FASTA)	NCBI Sequence Viewer
	XP_038963444	(Get FASTA)	NCBI Sequence Viewer
	XP_063142056	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79399	(Get FASTA)	NCBI Sequence Viewer
	EDM15251	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031535.5
	ENSRNOP00000073944.2
	ENSRNOP00000079323.1
	ENSRNOP00000084579.1
GenBank Protein	Q68FR5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014077 ⟸ NM_001014055
- Peptide Label:	isoform 1
- UniProtKB:	Q68FR5 (UniProtKB/Swiss-Prot), A6IEG4 (UniProtKB/TrEMBL), A0A8L2QHN8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMQGEVSPSPSLIDRTIRMRKETESRKVVLAWGLLNVSMAGMIYTEMTGKLISTYYNVTYWPLW YIELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQTLLGLKPAVVQTTPPRDLAATQISPS PPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPAVTYSPVSGYSKL ASFSLSPSSPYPTTVGPVESSGLRARYRSPPTAYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRV KLGSPDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEEVWA RVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVSTQMRRMGCPELQIGEASVTSLKQAA LVKAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRRWDTDLPTDSA IIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTNENVFCVYQSAINPPHYELIYQR HVYSLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFGE hide sequence

Ensembl Acc Id:

ENSRNOP00000031535 ⟸ ENSRNOT00000032772

Ensembl Acc Id:

ENSRNOP00000073944 ⟸ ENSRNOT00000091255

RefSeq Acc Id:	XP_038963444 ⟸ XM_039107516
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000079323 ⟸ ENSRNOT00000108938

Ensembl Acc Id:

ENSRNOP00000084579 ⟸ ENSRNOT00000116575

RefSeq Acc Id:	NP_001381959 ⟸ NM_001395030
- Peptide Label:	isoform 2
- UniProtKB:	A0A8L2QHN8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001381958 ⟸ NM_001395029
- Peptide Label:	isoform 2
- UniProtKB:	A0A8L2QHN8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063142056 ⟸ XM_063285986
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FR5-F1-model_v2	AlphaFold	Q68FR5	1-561	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692934

Promoter ID:

EPDNEW_R3459

Type:

multiple initiation site

Name:

Tmem209_1

Description:

transmembrane protein 209

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	57,823,282 - 57,823,342	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309682	AgrOrtholog
BioCyc Gene	G2FUF-45352	BioCyc
Ensembl Genes	ENSRNOG00000028219	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032772.6	UniProtKB/TrEMBL
	ENSRNOT00000091255.2	UniProtKB/TrEMBL
	ENSRNOT00000108938.1	UniProtKB/TrEMBL
	ENSRNOT00000116575.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7112633	IMAGE-MGC_LOAD
InterPro	Cytochrome_B561-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:312200	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94930	IMAGE-MGC_LOAD
NCBI Gene	312200	ENTREZGENE
PANTHER	PTHR21780	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEIN 209	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CytochromB561_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tmem209	PhenoGen
RatGTEx	ENSRNOG00000028219	RatGTEx
UniProt	A0A0G2K6U3_RAT	UniProtKB/TrEMBL
	A0A8I5ZMG9_RAT	UniProtKB/TrEMBL
	A0A8I5ZYA1_RAT	UniProtKB/TrEMBL
	A0A8L2QHN8	ENTREZGENE, UniProtKB/TrEMBL
	A6IEG4	ENTREZGENE, UniProtKB/TrEMBL
	Q68FR5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-18	Tmem209	transmembrane protein 209	RGD1309682	similar to hypothetical protein FLJ14803	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1309682	similar to hypothetical protein FLJ14803	RGD1309682_predicted	similar to hypothetical protein FLJ14803 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309682_predicted	similar to hypothetical protein FLJ14803 (predicted)	LOC312200_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC312200_predicted	similar to hypothetical protein FLJ14803 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar