Advanced Search (OLGA)

Gene: Acot6 (acyl-CoA thioesterase 6) Rattus norvegicus

Analyze

Symbol:

Acot6

Name:

acyl-CoA thioesterase 6

RGD ID:

1309669

Description:

Predicted to enable fatty acyl-CoA hydrolase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid metabolic process. Predicted to be located in cytosol. Orthologous to human ACOT6 (acyl-CoA thioesterase 6); INTERACTS WITH 1,2-dimethylhydrazine; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

acyl-coenzyme A thioesterase 6; LOC299193; RGD1309669; similar to Cytosolic acyl coenzyme A thioester hydrolase, inducible (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (LACH2) (ACH2)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACOT6 (acyl-CoA thioesterase 6)	HGNC	Ensembl, NCBI, Panther, Treefam
Mus musculus (house mouse):	Acot6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACOT6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACOT6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acot6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACOT6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACOT6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acot6 (acyl-CoA thioesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ACOT4 (acyl-CoA thioesterase 4)	HGNC	OrthoDB
Homo sapiens (human):	ACOT2 (acyl-CoA thioesterase 2)	HGNC	OrthoDB
Homo sapiens (human):	ACOT1 (acyl-CoA thioesterase 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	ACOT6 (acyl-CoA thioesterase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ACOT6 (acyl-CoA thioesterase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Acot6 (acyl-CoA thioesterase 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C31H5.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C31H5.6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K05B2.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K05B2.4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T05E7.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T05E7.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	acot20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	W03D8.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	W03D8.8	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	acot22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	acot21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acot2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acot2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100498625	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	109,463,513 - 109,472,587 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	6	103,732,372 - 103,741,446 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	103,732,372 - 103,741,446 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	103,894,180 - 103,903,254 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	104,193,399 - 104,202,473 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	103,562,847 - 103,571,921 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	107,581,357 - 107,590,431 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	107,581,608 - 107,590,373 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	117,946,002 - 117,963,918 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	108,146,690 - 108,155,388 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	101,561,356 - 101,570,442 (+)	NCBI		Celera
RGSC_v3.1	6	108,150,145 - 108,193,873 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (EXP,ISO)

17beta-estradiol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

acetamide (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

dichloroacetic acid (ISO)

ethanol (ISO)

farnesol (ISO)

folic acid (ISO)

GW 4064 (ISO)

inulin (ISO)

malathion (ISO)

melatonin (ISO)

oleic acid (ISO)

Ortho-topolin riboside (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

testosterone (ISO)

Theaflavin 3,3'-digallate (ISO)

trichloroethene (EXP,ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytosol (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16940157

Genomics

Comparative Map Data

Acot6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	109,463,513 - 109,472,587 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	6	103,732,372 - 103,741,446 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	103,732,372 - 103,741,446 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	103,894,180 - 103,903,254 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	104,193,399 - 104,202,473 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	103,562,847 - 103,571,921 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	107,581,357 - 107,590,431 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	107,581,608 - 107,590,373 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	117,946,002 - 117,963,918 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	108,146,690 - 108,155,388 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	101,561,356 - 101,570,442 (+)	NCBI		Celera
RGSC_v3.1	6	108,150,145 - 108,193,873 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

ACOT6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	73,610,945 - 73,619,888 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	73,610,945 - 73,619,888 (+)	Ensembl			hg38	GRCh38
GRCh37	14	74,077,649 - 74,086,592 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	73,153,301 - 73,156,345 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	14	54,119,631 - 54,122,671 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	54,251,313 - 54,254,353 (+)	NCBI		HuRef
CHM1_1	14	74,023,109 - 74,026,149 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	67,818,457 - 67,827,400 (+)	NCBI		T2T-CHM13v2.0

Acot6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	84,147,538 - 84,158,128 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	84,147,428 - 84,158,123 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	84,100,654 - 84,109,783 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	84,100,654 - 84,111,349 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	85,441,604 - 85,450,733 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	84,990,402 - 85,001,102 (+)	NCBI		MGSCv36	mm8
Celera	12	85,547,614 - 85,556,743 (+)	NCBI		Celera
Cytogenetic Map	12	D1	NCBI
cM Map	12	39.04	NCBI

ACOT6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	74,691,158 - 74,709,999 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	73,907,658 - 73,926,511 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	54,171,652 - 54,179,322 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	73,029,435 - 73,037,223 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	73,034,520 - 73,037,170 (+)	Ensembl			panPan2	panpan1.1

ACOT6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	46,905,354 - 46,911,627 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	46,852,880 - 46,911,640 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	46,589,770 - 46,595,919 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	47,134,480 - 47,140,629 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	47,081,692 - 47,140,579 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	46,802,068 - 46,808,222 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	46,820,344 - 46,826,490 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	47,210,706 - 47,216,944 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Acot6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	29,130,634 - 29,138,703 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	2,930,114 - 2,939,325 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	2,930,291 - 2,938,300 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACOT6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	96,984,716 - 96,992,873 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	96,984,547 - 96,990,400 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	102,742,804 - 102,785,288 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACOT6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	50,826,561 - 50,834,462 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666053	39,008,311 - 39,016,103 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acot6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	27,901,129 - 27,908,976 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Acot6
169 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	82
Interacting mature miRNAs:	88
Transcripts:	ENSRNOT00000058101
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	6	46	129	86	85	57	24	57	6	215	90	111	49	90	28	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001305285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058101 ⟹ ENSRNOP00000054907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	103,732,372 - 103,741,446 (+)	Ensembl
Rnor_6.0 Ensembl	6	107,581,608 - 107,590,373 (+)	Ensembl

RefSeq Acc Id:

NM_001305285 ⟹ NP_001292214

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	109,463,513 - 109,472,587 (+)	NCBI
mRatBN7.2	6	103,732,372 - 103,741,446 (+)	NCBI
Rnor_6.0	6	107,581,357 - 107,590,431 (+)	NCBI
Celera	6	101,561,356 - 101,570,442 (+)	NCBI

Sequence:

show sequence

TCCTCAACACTATGTGGACAGAATCCTCTGTGGTGGAGAGTGCCACTGCTGCTACTCTGACCTA
CATCCTTCCTGTATATAGTCAGCCTGTTTTCTGTCCCTGTCTTGTCTGAGGCACGTGAGCCAGG
GATAGGGAACTCTCAGAGACGGCACTAGGTTTCCTCTACAGCAGGTCAGGCTCTCCTCCACAGC
AGGCCAGGCTCCGCTCCGAACTCAACTCGCGTGGCACTACACGAGGTTTCCAGCTCCCTATGGC
GGCGACGCTTACTCTGGAGCCCGCCGGCCGCAGTTGCTGGGACGAGCCGCTGAGCATCGTCCTG
AGCGGCCTGGCCCCGGAGCAGTCTGTCACACTATGCTCGGCCCTGCGCGACGAGAAGGGTGTGC
TCTTCCGAGCCCACGCGCTCTACCGCGCTGATGTCCAAGGAGAGCTGAACCTGGCGCTCGCTCC
CGCGCTGGGCGGCAGCTTCACGGGGCTCGAGCCCATGGGGCTGATATGGGCCATGGAGCCCGAA
CGGCCTTTCTGGCGTTTGATCAAGCGCGACGTGCAGACGCCCTTAGTGGTGGAGCTGGAGGTGC
TGGACGGACACGAGCCCGACGGCGGTCAGCGGCTTGCACAGGCGGTGCACGAGCGTCACTTCAT
GGCTCCCGGGGTGCGGCGCGTGCCCGTGCGCGAGGGCAGGGTGCGCGCCACGCTCTTCCTGCCC
CCAGGCGAGGGCCAGTTCTCTGGGATTATTGACTTGTATGGAAGTATTGGTGGCTTACGTGAGT
ACAGAGCCAGCCTCCTGGCTGGGCATGGTTTTGCTGTGCTTGCTCTGGCTTATTTCCAATTTGA
AGACCTCCCTGAATATTTGAGCCAAGTGCATCTGGAGTACTTTGAAGAAGCTGTGACCTTCATG
CTGCACCATCCACAGGTGAAAGGTCCAAATATTGGGCTTCTTGGGATCTCCAAAGGCGGTGACC
TGTGCCTCTCGATGGCTGCTTTCCTGAAGGACAAAATCACAGCCACTGTCCTTATAAATGCCTG
TGTGGCCAACACCTTAGCCCCTCTGTATTACAAGGATATGTTTATTCCTAATCTTGGGTATGAC
CCAACAAAACATAAGATCTTGGAGTCAGGCCTTTTGGATTTGGGGGATATTTGGAACAACCCAC
TGGAGGAACCCAACCACCAAAGTCTTATTTCATTGGAGAAGGCCCAGGGACCCTTCTTGTTTAT
TGTGGGCATGGATGATCATAGCTGGAAAAGTGACGTCTATGCTCGTATAGCCAGTAGACGTCTA
CAAGCCCACGGAAAAGACAGACCCCAGATAATCTACTATCCAAAAAGTGGTCACTGTATTGACC
CACCCTATTTTCCTCCTCCCATAGCCTTTGTACCTACGGCAGTGAGTGGACCGATACTCTCTGG
AGGTGAGCCAAGGGCTCAGTCAAGGGCACAGTTGGATGCCTGGCAACGCATTCAAACTTTCTTC
CGAAAGTATCTCAATGGTGAAAAACCTGCCAGGCATAGCAAAATGTAACATTGTGATTCTAGAG
AAAGTTCTAATGATGCCATGCAGATTCTTTTGAATTTCCGGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001292214	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL81475	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001292214 ⟸ NM_001305285

- UniProtKB:

D3ZSE3 (UniProtKB/TrEMBL), A6JDT1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATLTLEPAGRSCWDEPLSIVLSGLAPEQSVTLCSALRDEKGVLFRAHALYRADVQGELNLAL
APALGGSFTGLEPMGLIWAMEPERPFWRLIKRDVQTPLVVELEVLDGHEPDGGQRLAQAVHERH
FMAPGVRRVPVREGRVRATLFLPPGEGQFSGIIDLYGSIGGLREYRASLLAGHGFAVLALAYFQ
FEDLPEYLSQVHLEYFEEAVTFMLHHPQVKGPNIGLLGISKGGDLCLSMAAFLKDKITATVLIN
ACVANTLAPLYYKDMFIPNLGYDPTKHKILESGLLDLGDIWNNPLEEPNHQSLISLEKAQGPFL
FIVGMDDHSWKSDVYARIASRRLQAHGKDRPQIIYYPKSGHCIDPPYFPPPIAFVPTAVSGPIL
SGGEPRAQSRAQLDAWQRIQTFFRKYLNGEKPARHSKM

hide sequence

Ensembl Acc Id:

ENSRNOP00000054907 ⟸ ENSRNOT00000058101

Protein Domains

Acyl-CoA thioester hydrolase/bile acid-CoA amino BAAT/Acyl-CoA thioester hydrolase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZSE3-F1-model_v2	AlphaFold	D3ZSE3	1-422	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309669	AgrOrtholog
BioCyc Gene	G2FUF-36839	BioCyc
BioCyc Pathway	PWY-5148 [acyl-CoA hydrolysis]	BioCyc
	PWY-5972 [stearate biosynthesis I (animals)]	BioCyc
	PWY-5996 [oleate biosynthesis II (animals and fungi)]	BioCyc
	PWY-8042 [acylceramide biosynthesis]	BioCyc
	PWY3O-1801 [palmitoleate biosynthesis IV (fungi and animals)]	BioCyc
BioCyc Pathway Image	PWY-5148	BioCyc
	PWY-5972	BioCyc
	PWY-5996	BioCyc
	PWY-8042	BioCyc
	PWY3O-1801	BioCyc
Ensembl Genes	ENSRNOG00000029637	Ensembl
Gene3D-CATH	2.60.40.2240	UniProtKB/TrEMBL
	3.40.50.1820	UniProtKB/TrEMBL
InterPro	AB_hydrolase	UniProtKB/TrEMBL
	Acyl-CoA_thioEstase_long-chain	UniProtKB/TrEMBL
	BAAT_C	UniProtKB/TrEMBL
	Thio_Ohase/aa_AcTrfase	UniProtKB/TrEMBL
	Thio_Ohase/BAAT_N	UniProtKB/TrEMBL
KEGG Report	rno:299193	UniProtKB/TrEMBL
NCBI Gene	299193	ENTREZGENE
PANTHER	ACYL-COENZYME A THIOESTERASE 6-RELATED	UniProtKB/TrEMBL
	ACYL-COENZYME A THIOESTERASE-RELATED	UniProtKB/TrEMBL
Pfam	BAAT_C	UniProtKB/TrEMBL
	Bile_Hydr_Trans	UniProtKB/TrEMBL
PhenoGen	Acot6	PhenoGen
PIRSF	Acyl-CoA_hydro	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000029637	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/TrEMBL
UniProt	A6JDT1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZSE3	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Acot6	acyl-CoA thioesterase 6	RGD1309669_predicted	similar to Cytosolic acyl coenzyme A thioester hydrolase, inducible (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (LACH2) (ACH2) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	RGD1309669_predicted	similar to Cytosolic acyl coenzyme A thioester hydrolase, inducible (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (LACH2) (ACH2) (predicted)	LOC679313	similar to acyl-CoA thioesterase 5	Data merged from RGD:1589556	1643240	APPROVED
2006-11-19	LOC679313	similar to acyl-CoA thioesterase 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-20	RGD1309669_predicted	similar to Cytosolic acyl coenzyme A thioester hydrolase, inducible (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (LACH2) (ACH2) (predicted)	LOC299193_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC299193_predicted	similar to Cytosolic acyl coenzyme A thioester hydrolase, inducible (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (LACH2) (ACH2) (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

BioCyc Pathways