Symbol:
Trem1
Name:
triggering receptor expressed on myeloid cells 1
RGD ID:
1309467
Description:
Predicted to enable receptor decoy activity; scaffold protein binding activity; and transmembrane signaling receptor activity. Involved in several processes, including cellular response to lipopolysaccharide; cellular response to vitamin D; and positive regulation of macrophage chemotaxis. Predicted to be located in plasma membrane. Predicted to be active in cell surface and extracellular space. Used to study several diseases, including acute pancreatitis; bacterial sepsis; mesenteric vascular occlusion; middle cerebral artery infarction; and pleural empyema. Biomarker of congestive heart failure; depressive disorder; periodontitis; and rheumatoid arthritis. Human ortholog(s) of this gene implicated in bacterial sepsis and malaria. Orthologous to human TREM1 (triggering receptor expressed on myeloid cells 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC301229
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 20,259,227 - 20,276,879 (-) NCBI GRCr8 mRatBN7.2 9 12,763,819 - 12,779,285 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 12,763,819 - 12,779,203 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 21,277,179 - 21,288,238 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 26,343,405 - 26,354,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 24,732,622 - 24,743,689 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 14,727,887 - 14,743,371 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 14,727,976 - 14,809,447 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 13,649,246 - 13,664,645 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 8,175,081 - 8,186,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 8,175,083 - 8,193,441 (-) NCBI Celera 9 10,535,490 - 10,546,547 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trem1 Rat (S)-nicotine increases expression ISO TREM1 (Homo sapiens) 6480464 Nicotine results in increased expression of TREM1 mRNA CTD PMID:23825647 Trem1 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO TREM1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of TREM1 protein CTD PMID:33774146 Trem1 Rat 1-chloro-2,4-dinitrobenzene affects expression ISO TREM1 (Homo sapiens) 6480464 Dinitrochlorobenzene affects the expression of TREM1 mRNA CTD PMID:33774146 Trem1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TREM1 mRNA CTD PMID:34747641 Trem1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Trem1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Trem1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO TREM1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of TREM1 mRNA CTD PMID:25461914 Trem1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TREM1 mRNA CTD PMID:31881176 Trem1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TREM1 mRNA CTD PMID:28959563 Trem1 Rat all-trans-retinoic acid increases expression ISO TREM1 (Homo sapiens) 6480464 Tretinoin results in increased expression of TREM1 mRNA CTD PMID:33167477 Trem1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TREM1 mRNA CTD PMID:30779732 Trem1 Rat amphotericin B decreases expression ISO TREM1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of TREM1 mRNA CTD PMID:28534445 Trem1 Rat antirheumatic drug decreases expression ISO TREM1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TREM1 mRNA CTD PMID:24449571 Trem1 Rat arsane decreases expression ISO Trem1 (Mus musculus) 6480464 Arsenic results in decreased expression of TREM1 mRNA CTD PMID:19654921 Trem1 Rat arsenic atom decreases expression ISO Trem1 (Mus musculus) 6480464 Arsenic results in decreased expression of TREM1 mRNA CTD PMID:19654921 Trem1 Rat benzo[a]pyrene decreases expression ISO TREM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TREM1 mRNA CTD PMID:22316170 Trem1 Rat benzo[a]pyrene increases methylation ISO TREM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TREM1 promoter CTD PMID:27901495 Trem1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TREM1 mRNA CTD PMID:25181051 Trem1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TREM1 gene CTD PMID:28505145 Trem1 Rat cadmium atom multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression of TREM1 mRNA CTD PMID:21481475 Trem1 Rat calcitriol increases expression ISO TREM1 (Homo sapiens) 6480464 Calcitriol results in increased expression of TREM1 mRNA CTD PMID:26485663 Trem1 Rat carbon nanotube increases expression ISO TREM1 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of TREM1 mRNA CTD PMID:29348435 Trem1 Rat CGP 52608 multiple interactions ISO TREM1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TREM1 gene] CTD PMID:28238834 Trem1 Rat choline multiple interactions ISO Trem1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TREM1 mRNA CTD PMID:20938992 Trem1 Rat chromium(6+) multiple interactions ISO TREM1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TREM1 mRNA CTD PMID:38479592 Trem1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TREM1 mRNA CTD PMID:26033743 Trem1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TREM1 mRNA CTD PMID:26033743 Trem1 Rat crocidolite asbestos increases expression ISO TREM1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of TREM1 mRNA CTD PMID:23634900 Trem1 Rat curcumin decreases expression ISO TREM1 (Homo sapiens) 6480464 Curcumin results in decreased expression of TREM1 mRNA CTD PMID:17198877 Trem1 Rat cyclosporin A increases expression ISO TREM1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TREM1 mRNA CTD PMID:25562108 Trem1 Rat cyclosporin A decreases expression ISO TREM1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TREM1 mRNA CTD PMID:33631201 Trem1 Rat diallyl disulfide multiple interactions ISO TREM1 (Homo sapiens) 6480464 diallyl disulfide inhibits the reaction [tobacco tar analog results in increased expression of TREM1 mRNA] CTD PMID:36758788 Trem1 Rat Dibutyl phosphate affects expression ISO TREM1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TREM1 mRNA CTD PMID:37042841 Trem1 Rat dioxygen multiple interactions ISO Trem1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TREM1 mRNA CTD PMID:30529165 Trem1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of TREM1 mRNA CTD PMID:33729688 Trem1 Rat doxorubicin affects expression ISO TREM1 (Homo sapiens) 6480464 Doxorubicin affects the expression of TREM1 mRNA CTD PMID:29803840 Trem1 Rat elemental selenium multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression of TREM1 mRNA CTD PMID:21481475 Trem1 Rat folic acid multiple interactions ISO Trem1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TREM1 mRNA CTD PMID:20938992 Trem1 Rat kojic acid decreases expression ISO TREM1 (Homo sapiens) 6480464 kojic acid results in decreased expression of TREM1 mRNA CTD PMID:16595896 Trem1 Rat L-methionine multiple interactions ISO Trem1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TREM1 mRNA CTD PMID:20938992 Trem1 Rat lipopolysaccharide increases expression ISO Trem1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TREM1 mRNA CTD PMID:20453108 and PMID:25890327 Trem1 Rat nickel dichloride increases expression ISO TREM1 (Homo sapiens) 6480464 nickel chloride results in increased expression of TREM1 protein CTD PMID:33774146 Trem1 Rat nickel dichloride affects expression ISO TREM1 (Homo sapiens) 6480464 nickel chloride affects the expression of TREM1 mRNA CTD PMID:33774146 Trem1 Rat nicotine increases expression ISO TREM1 (Homo sapiens) 6480464 Nicotine results in increased expression of TREM1 mRNA CTD PMID:23825647 Trem1 Rat ozone increases expression ISO TREM1 (Homo sapiens) 6480464 Ozone results in increased expression of TREM1 mRNA CTD PMID:23033980 Trem1 Rat ozone multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TREM1 mRNA CTD PMID:35430440 Trem1 Rat ozone multiple interactions ISO Trem1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TREM1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of TREM1 mRNA CTD PMID:34911549 Trem1 Rat paracetamol affects expression ISO Trem1 (Mus musculus) 6480464 Acetaminophen affects the expression of TREM1 mRNA CTD PMID:17562736 Trem1 Rat paricalcitol multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of TREM1 mRNA CTD PMID:17715259 Trem1 Rat perfluorohexanesulfonic acid multiple interactions ISO TREM1 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in decreased expression of TREM1 mRNA CTD PMID:38603627 Trem1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO TREM1 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in decreased expression of TREM1 mRNA CTD PMID:38603627 Trem1 Rat perfluorooctanoic acid multiple interactions ISO TREM1 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in decreased expression of TREM1 mRNA CTD PMID:38603627 Trem1 Rat phosphorus atom multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of TREM1 mRNA CTD PMID:17715259 Trem1 Rat phosphorus(.) multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of TREM1 mRNA CTD PMID:17715259 Trem1 Rat selenium atom multiple interactions ISO TREM1 (Homo sapiens) 6480464 [Cadmium analog co-treated with Selenium analog co-treated with zinc sulfide analog] results in increased expression of TREM1 mRNA CTD PMID:21481475 Trem1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of TREM1 mRNA CTD PMID:21602193 and PMID:22431001 Trem1 Rat silicon dioxide increases expression ISO TREM1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of TREM1 mRNA CTD PMID:25351596 Trem1 Rat silicon dioxide increases expression ISO Trem1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of TREM1 mRNA CTD PMID:23221170 Trem1 Rat sodium arsenite decreases expression ISO TREM1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TREM1 mRNA CTD PMID:29301061 Trem1 Rat sodium arsenite decreases expression ISO Trem1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TREM1 mRNA CTD PMID:37682722 Trem1 Rat sodium arsenite increases expression ISO TREM1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TREM1 mRNA CTD PMID:38568856 Trem1 Rat sulforaphane increases expression ISO TREM1 (Homo sapiens) 6480464 sulforaphane results in increased expression of TREM1 mRNA CTD PMID:26833863 Trem1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TREM1 mRNA CTD PMID:34492290 Trem1 Rat thiram increases expression ISO TREM1 (Homo sapiens) 6480464 Thiram results in increased expression of TREM1 mRNA CTD PMID:38568856 Trem1 Rat titanium dioxide increases expression ISO Trem1 (Mus musculus) 6480464 titanium dioxide results in increased expression of TREM1 mRNA CTD PMID:23557971 Trem1 Rat triphenyl phosphate affects expression ISO TREM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TREM1 mRNA CTD PMID:37042841 Trem1 Rat XL147 multiple interactions ISO Trem1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of TREM1 mRNA CTD PMID:27935865 Trem1 Rat zinc sulfate decreases expression ISO TREM1 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of TREM1 mRNA CTD PMID:12756304
(S)-nicotine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) acetamide (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) amphetamine (EXP) amphotericin B (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) cadmium atom (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) diallyl disulfide (ISO) Dibutyl phosphate (ISO) dioxygen (EXP,ISO) doxorubicin (ISO) elemental selenium (ISO) folic acid (ISO) kojic acid (ISO) L-methionine (ISO) lipopolysaccharide (ISO) nickel dichloride (ISO) nicotine (ISO) ozone (ISO) paracetamol (ISO) paricalcitol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) selenium atom (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sulforaphane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) XL147 (ISO) zinc sulfate (ISO)
1.
Triggering receptor expressed on myeloid cells 1 (TREM-1) and cytokine gene variants in complicated and uncomplicated malaria.
Adukpo S, etal., Trop Med Int Health. 2016 Dec;21(12):1592-1601. doi: 10.1111/tmi.12787. Epub 2016 Oct 24.
2.
TREM-1 Mediates Inflammatory Injury and Cardiac Remodeling Following Myocardial Infarction.
Boufenzer A, etal., Circ Res. 2015 May 22;116(11):1772-82. doi: 10.1161/CIRCRESAHA.116.305628. Epub 2015 Apr 3.
3.
Triggering receptor expressed on myeloid cells-1 (TREM-1) modulates immune responses to Aspergillus fumigatus during fungal asthma in mice.
Buckland KF, etal., Immunol Invest. 2011;40(7-8):692-722. doi: 10.3109/08820139.2011.578270. Epub 2011 May 19.
4.
Triggering receptor expressed on myeloid cells (TREM)-1 participates in Schistosoma mansoni inflammatory responses.
Cheng PC, etal., Parasite Immunol. 2011 May;33(5):276-86. doi: 10.1111/j.1365-3024.2011.01284.x.
5.
Soluble triggering receptor expressed on myeloid cells 1: a biomarker for bacterial meningitis.
Determann RM, etal., Intensive Care Med. 2006 Aug;32(8):1243-7. doi: 10.1007/s00134-006-0240-4. Epub 2006 Jun 20.
6.
Triptolide Modulates TREM-1 Signal Pathway to Inhibit the Inflammatory Response in Rheumatoid Arthritis.
Fan D, etal., Int J Mol Sci. 2016 Apr 2;17(4):498. doi: 10.3390/ijms17040498.
7.
Quercetin Alleviates LPS-Induced Depression-Like Behavior in Rats via Regulating BDNF-Related Imbalance of Copine 6 and TREM1/2 in the Hippocampus and PFC.
Fang K, etal., Front Pharmacol. 2020 Jan 17;10:1544. doi: 10.3389/fphar.2019.01544. eCollection 2019.
8.
Role of TREM-1 in pulmonary tuberculosis patients- analysis of serum soluble TREM-1 levels.
Feng JY, etal., Sci Rep. 2018 May 29;8(1):8223. doi: 10.1038/s41598-018-26478-2.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Effects of the TREM-1 pathway modulation during mesenteric ischemia-reperfusion in rats.
Gibot S, etal., Crit Care Med. 2008 Feb;36(2):504-10. doi: 10.1097/01.CCM.0B013E318161FAF3.
11.
TREM-1 promotes survival during septic shock in mice.
Gibot S, etal., Eur J Immunol. 2007 Feb;37(2):456-66. doi: 10.1002/eji.200636387.
12.
Modulation of the triggering receptor expressed on myeloid cells-1 pathway during pneumonia in rats.
Gibot S, etal., J Infect Dis. 2006 Oct 1;194(7):975-83. doi: 10.1086/506950. Epub 2006 Aug 29.
13.
Effects of the TREM 1 pathway modulation during hemorrhagic shock in rats.
Gibot S, etal., Shock. 2009 Dec;32(6):633-7. doi: 10.1097/SHK.0b013e3181a53842.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
In familial Mediterranean fever, soluble TREM-1 plasma level is higher in case of amyloidosis.
Gorlier C, etal., Innate Immun. 2019 Nov;25(8):487-490. doi: 10.1177/1753425919870847. Epub 2019 Aug 31.
16.
Triggering receptor expressed on myeloid cells-1 (TREM-1) improves host defence in pneumococcal pneumonia.
Hommes TJ, etal., J Pathol. 2014 Aug;233(4):357-67. doi: 10.1002/path.4361. Epub 2014 Jun 3.
17.
HIV and HCV augments inflammatory responses through increased TREM-1 expression and signaling in Kupffer and Myeloid cells.
Hyun J, etal., PLoS Pathog. 2019 Jul 1;15(7):e1007883. doi: 10.1371/journal.ppat.1007883. eCollection 2019 Jul.
18.
Forsythoside B protects against experimental sepsis by modulating inflammatory factors.
Jiang WL, etal., Phytother Res. 2012 Jul;26(7):981-7. doi: 10.1002/ptr.3668. Epub 2011 Dec 6.
19.
Role of triggering receptor expressed on myeloid cells-1 in experimental severe acute pancreatitis.
Kamei K, etal., J Hepatobiliary Pancreat Sci. 2010 May;17(3):305-12. doi: 10.1007/s00534-009-0191-6. Epub 2009 Sep 29.
20.
Cutting edge: expression patterns of surface and soluble triggering receptor expressed on myeloid cells-1 in human endotoxemia.
Knapp S, etal., J Immunol. 2004 Dec 15;173(12):7131-4. doi: 10.4049/jimmunol.173.12.7131.
21.
Attenuated viral hepatitis in Trem1-/- mice is associated with reduced inflammatory activity of neutrophils.
Kozik JH, etal., Sci Rep. 2016 Jun 22;6:28556. doi: 10.1038/srep28556.
22.
Amniotic fluid sTREM-1 in normal pregnancy, spontaneous parturition at term and preterm, and intra-amniotic infection/inflammation.
Kusanovic JP, etal., J Matern Fetal Neonatal Med. 2010 Jan;23(1):34-47. doi: 10.3109/14767050903009248.
23.
TREM-1 activation alters the dynamics of pulmonary IRAK-M expression in vivo and improves host defense during pneumococcal pneumonia.
Lagler H, etal., J Immunol. 2009 Aug 1;183(3):2027-36. doi: 10.4049/jimmunol.0803862. Epub 2009 Jul 13.
24.
TREM-1-targeting LP17 attenuates cerebral ischemia-induced neuronal injury by inhibiting oxidative stress and pyroptosis.
Liang YB, etal., Biochem Biophys Res Commun. 2020 Aug 27;529(3):554-561. doi: 10.1016/j.bbrc.2020.05.056. Epub 2020 Jul 15.
25.
TREM-1 promotes survival during Klebsiella pneumoniae liver abscess in mice.
Lin YT, etal., Infect Immun. 2014 Mar;82(3):1335-42. doi: 10.1128/IAI.01347-13. Epub 2014 Jan 6.
26.
High Expression Levels of Trigger Receptor Expressed on Myeloid Cells-1 on Neutrophils Associated with Increased Severity of Acute Pancreatitis in Mice.
Liu M, etal., Biol Pharm Bull. 2015;38(10):1450-7. doi: 10.1248/bpb.b15-00057. Epub 2015 Aug 5.
27.
Etomidate Mitigates Lipopolysaccharide-Induced CD14 and TREM-1 Expression, NF-κB Activation, and Pro-inflammatory Cytokine Production in Rat Macrophages.
Liu M, etal., Inflammation. 2016 Feb;39(1):327-335. doi: 10.1007/s10753-015-0253-7.
28.
Effects of the TREM-1 pathway modulation during empyema in rats.
Luo L, etal., Chin Med J (Engl). 2010 Jun;123(12):1561-5.
29.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
30.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
31.
Triggering receptor expressed on myeloid cells-1 (TREM-1) expression on gastric epithelium: implication for a role of TREM-1 in Helicobacter pylori infection.
Schmausser B, etal., Clin Exp Immunol. 2008 Apr;152(1):88-94. doi: 10.1111/j.1365-2249.2008.03608.x.
32.
Value of soluble TREM-1, procalcitonin, and C-reactive protein serum levels as biomarkers for detecting bacteremia among sepsis patients with new fever in intensive care units: a prospective cohort study.
Su L, etal., BMC Infect Dis. 2012 Jul 18;12:157. doi: 10.1186/1471-2334-12-157.
33.
Role of TREM-1 in the development of early brain injury after subarachnoid hemorrhage.
Sun XG, etal., Exp Neurol. 2021 Jul;341:113692. doi: 10.1016/j.expneurol.2021.113692. Epub 2021 Mar 13.
34.
Inhibition of TREM-1 attenuates early brain injury after subarachnoid hemorrhage via downregulation of p38MAPK/MMP-9 and preservation of ZO-1.
Sun XG, etal., Neuroscience. 2019 May 15;406:369-375. doi: 10.1016/j.neuroscience.2019.03.032. Epub 2019 Mar 23.
35.
Association of Inflammatory Responses and ECM Disorganization with HMGB1 Upregulation and NLRP3 Inflammasome Activation in the Injured Rotator Cuff Tendon.
Thankam FG, etal., Sci Rep. 2018 Jun 11;8(1):8918. doi: 10.1038/s41598-018-27250-2.
36.
Azithromycin acts as an immunomodulatory agent to suppress the expression of TREM-1 in Bacillus pyocyaneus-induced sepsis.
Tong J, etal., Immunol Lett. 2011 Aug 30;138(2):137-43. doi: 10.1016/j.imlet.2011.04.001. Epub 2011 Apr 9.
37.
Gene expression analysis of TREM1 and GRK2 in polymorphonuclear leukocytes as the surrogate biomarkers of acute bacterial infections.
Ubagai T, etal., Int J Med Sci. 2014 Jan 10;11(2):215-21. doi: 10.7150/ijms.7231. eCollection 2014.
38.
Evaluation of TREM1 gene expression in circulating polymorphonuclear leukocytes and its inverse correlation with the severity of pathophysiological conditions in patients with acute bacterial infections.
Ubagai T, etal., Jpn J Infect Dis. 2012;65(5):376-82. doi: 10.7883/yoken.65.376.
39.
TREM-1 deficiency can attenuate disease severity without affecting pathogen clearance.
Weber B, etal., PLoS Pathog. 2014 Jan;10(1):e1003900. doi: 10.1371/journal.ppat.1003900. Epub 2014 Jan 16.
40.
[The effect of signal transduction pathway of triggering receptor-1 expressed on myeloid cells in acute lung injury induced by paraquat in rats].
Wei M, etal., Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2015 Sep;33(9):646-51.
41.
Expression profile and function of triggering receptor expressed on myeloid cells-1 during melioidosis.
Wiersinga WJ, etal., J Infect Dis. 2007 Dec 1;196(11):1707-16. doi: 10.1086/522141. Epub 2007 Oct 25.
42.
[Temporal expression of triggering receptors expressed by myeloid cells-1 during the development of experimental periodontitis in rat].
Wu WC, etal., Zhonghua Kou Qiang Yi Xue Za Zhi. 2018 Mar 9;53(3):157-163. doi: 10.3760/cma.j.issn.1002-0098.2018.03.003.
43.
Shengxian decoction decreases doxorubicin‑induced cardiac apoptosis by regulating the TREM1/NF‑κB signaling pathway.
Yao L, etal., Mol Med Rep. 2021 Mar;23(3). pii: 219. doi: 10.3892/mmr.2021.11858. Epub 2021 Jan 26.
44.
Active vitamin D regulates macrophage M1/M2 phenotypes via the STAT-1-TREM-1 pathway in diabetic nephropathy.
Zhang X, etal., J Cell Physiol. 2019 May;234(5):6917-6926. doi: 10.1002/jcp.27450. Epub 2018 Nov 27.
45.
Vitamin D suppresses macrophage infiltration by down-regulation of TREM-1 in diabetic nephropathy rats.
Zhao Y, etal., Mol Cell Endocrinol. 2018 Sep 15;473:44-52. doi: 10.1016/j.mce.2018.01.001. Epub 2018 Jan 10.
46.
Inhibition of TREM-1 and Dectin-1 Alleviates the Severity of Fungal Keratitis by Modulating Innate Immune Responses.
Zhong J, etal., PLoS One. 2016 Mar 10;11(3):e0150114. doi: 10.1371/journal.pone.0150114. eCollection 2016.
47.
Inhibition of triggering receptor expressed on myeloid cells-1 ameliorates experimental autoimmune neuritis.
Zhou X, etal., Mol Med Rep. 2017 Apr;15(4):1565-1570. doi: 10.3892/mmr.2017.6167. Epub 2017 Feb 6.
48.
TREM-1 deficiency attenuates the inflammatory responses in LPS-induced murine endometritis.
Zhu H, etal., Microb Biotechnol. 2019 Nov;12(6):1337-1345. doi: 10.1111/1751-7915.13467. Epub 2019 Jul 31.
Trem1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 20,259,227 - 20,276,879 (-) NCBI GRCr8 mRatBN7.2 9 12,763,819 - 12,779,285 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 12,763,819 - 12,779,203 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 21,277,179 - 21,288,238 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 26,343,405 - 26,354,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 24,732,622 - 24,743,689 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 14,727,887 - 14,743,371 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 14,727,976 - 14,809,447 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 13,649,246 - 13,664,645 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 8,175,081 - 8,186,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 8,175,083 - 8,193,441 (-) NCBI Celera 9 10,535,490 - 10,546,547 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
TREM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 41,267,385 - 41,286,682 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 41,267,100 - 41,286,682 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 41,235,123 - 41,254,420 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 41,351,690 - 41,362,435 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 41,351,689 - 41,362,435 NCBI Celera 6 42,797,142 - 42,807,885 (-) NCBI Celera Cytogenetic Map 6 p21.1 NCBI HuRef 6 40,961,518 - 40,972,978 (-) NCBI HuRef CHM1_1 6 41,246,251 - 41,257,709 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 41,096,688 - 41,115,965 (-) NCBI T2T-CHM13v2.0
Trem1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 48,539,763 - 48,553,955 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 48,539,796 - 48,553,952 (+) Ensembl GRCm39 Ensembl GRCm38 17 48,232,713 - 48,246,927 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 48,232,768 - 48,246,924 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 48,371,922 - 48,386,091 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 47,698,178 - 47,712,333 (+) NCBI MGSCv36 mm8 Celera 17 51,668,001 - 51,682,161 (+) NCBI Celera Cytogenetic Map 17 C NCBI cM Map 17 23.99 NCBI
TREM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 55,770,728 - 55,782,228 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 51,639,052 - 51,652,228 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 40,861,283 - 40,874,446 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 42,168,992 - 42,182,134 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 42,163,337 - 42,183,091 (-) Ensembl panpan1.1 panPan2
TREM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 9,990,678 - 10,000,195 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 9,990,679 - 10,000,236 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 10,020,952 - 10,030,132 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 10,470,281 - 10,479,802 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 10,470,277 - 10,479,839 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 10,002,655 - 10,011,845 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 10,084,374 - 10,093,559 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 10,179,448 - 10,188,597 (-) NCBI UU_Cfam_GSD_1.0
Trem1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 45,374,752 - 45,385,967 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 18,574,381 - 18,583,647 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 18,577,825 - 18,583,675 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TREM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 36,510,253 - 36,531,796 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 36,510,253 - 36,531,796 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 41,804,122 - 41,825,672 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TREM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 30,873,647 - 30,885,292 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 30,873,666 - 30,886,967 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 41,275,669 - 41,288,974 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 182 Count of miRNA genes: 135 Interacting mature miRNAs: 145 Transcripts: ENSRNOT00000049193 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 61450 Ciaa3 CIA Autoantibody QTL 3 6.5 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 9 7954720 22071169 Rat 1578675 Bss17 Bone structure and strength QTL 17 3.8 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 9 3368652 13533896 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
43
55
89
89
58
25
58
6
201
90
36
36
51
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049193 ⟹ ENSRNOP00000040482
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 12,763,819 - 12,779,203 (-) Ensembl Rnor_6.0 Ensembl 9 14,727,976 - 14,809,447 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106823 ⟹ ENSRNOP00000084138
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 12,763,819 - 12,779,176 (-) Ensembl
RefSeq Acc Id:
NM_001106885 ⟹ NP_001100355
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,261,408 - 20,272,469 (-) NCBI mRatBN7.2 9 12,763,819 - 12,774,880 (-) NCBI Rnor_6.0 9 14,727,887 - 14,738,948 (-) NCBI Rnor_5.0 9 13,649,246 - 13,664,645 (-) NCBI RGSC_v3.4 9 8,175,081 - 8,186,142 (-) RGD Celera 9 10,535,490 - 10,546,547 (-) RGD
Sequence:
AAGTCAAAGCTGCCATTGTCCCAGAGGAAGAAAGGTATGATCTAGTTGAGGGCCAGACCTTGACAGTGAACTGTCCCTTCAACATCATGAAGTATGCCAGAAGCAGGAAGGCTTGGCAGAGGCTATCA
hide sequence
RefSeq Acc Id:
XM_039083174 ⟹ XP_038939102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,259,227 - 20,276,879 (-) NCBI mRatBN7.2 9 12,763,822 - 12,779,285 (-) NCBI
RefSeq Acc Id:
NP_001100355 ⟸ NM_001106885
- UniProtKB:
A6JIG5 (UniProtKB/TrEMBL)
- Sequence:
MKYARSRKAWQRLSAGKEPLTLVVTERSSTTSSEVRVGKYTLKDDPTEAMLFVQMTDLQVTDSGLYRCVIYHPPNDPVLLFHPVRLVVTKGSSGVSVPDIIPTTKPTEVPVLITTKHSTPTRSLPKST
hide sequence
Ensembl Acc Id:
ENSRNOP00000040482 ⟸ ENSRNOT00000049193
RefSeq Acc Id:
XP_038939102 ⟸ XM_039083174
- Peptide Label:
isoform X1
- UniProtKB:
D4ABU7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000084138 ⟸ ENSRNOT00000106823
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Trem1
triggering receptor expressed on myeloid cells 1
Trem1_predicted
triggering receptor expressed on myeloid cells 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Trem1_predicted
triggering receptor expressed on myeloid cells 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
