Symbol:
Chic2
Name:
cysteine-rich hydrophobic domain 2
RGD ID:
1309278
Description:
Predicted to be located in Golgi apparatus. Predicted to be active in Golgi-associated vesicle and plasma membrane. Human ortholog(s) of this gene implicated in acute myeloid leukemia. Orthologous to human CHIC2 (cysteine rich hydrophobic domain 2); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cysteine-rich hydrophobic domain 2 protein; cysteine-rich hydrophobic domain-containing protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 33,511,839 - 33,546,181 (+) NCBI GRCr8 mRatBN7.2 14 33,157,669 - 33,192,015 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 33,157,537 - 33,191,895 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 33,507,861 - 33,542,251 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 34,815,670 - 34,849,824 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 33,300,926 - 33,335,318 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 35,683,657 - 35,718,005 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 35,683,442 - 35,717,922 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 35,512,033 - 35,546,381 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 35,522,470 - 35,558,067 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 35,499,310 - 35,557,069 (+) NCBI Celera 14 32,427,860 - 32,462,239 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chic2 Rat 1,2-dimethylhydrazine multiple interactions ISO Chic2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHIC2 mRNA CTD PMID:22206623 Chic2 Rat 1,2-dimethylhydrazine decreases expression ISO Chic2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CHIC2 mRNA CTD PMID:22206623 Chic2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CHIC2 mRNA CTD PMID:32145629 Chic2 Rat 17beta-estradiol decreases expression ISO Chic2 (Mus musculus) 6480464 Estradiol results in decreased expression of CHIC2 mRNA CTD PMID:39298647 Chic2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Chic2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Chic2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CHIC2 mRNA CTD PMID:21570461 Chic2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CHIC2 mRNA CTD PMID:33387578 and PMID:34747641 Chic2 Rat 2-hydroxypropanoic acid decreases expression ISO CHIC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CHIC2 mRNA CTD PMID:30851411 Chic2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CHIC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CHIC2 mRNA CTD PMID:28628672 Chic2 Rat 3-methylcholanthrene multiple interactions ISO Chic2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in decreased expression of CHIC2 mRNA CTD PMID:25926378 Chic2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CHIC2 mRNA CTD PMID:28628672 Chic2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Chic2 (Mus musculus) 6480464 bisphenol S results in decreased expression of CHIC2 mRNA CTD PMID:39298647 Chic2 Rat 4-hydroxyphenyl retinamide increases expression ISO Chic2 (Mus musculus) 6480464 Fenretinide results in increased expression of CHIC2 mRNA CTD PMID:28973697 Chic2 Rat aflatoxin B1 decreases methylation ISO CHIC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CHIC2 gene CTD PMID:27153756 Chic2 Rat aflatoxin B1 increases expression ISO CHIC2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CHIC2 mRNA CTD PMID:27153756 Chic2 Rat aristolochic acid A increases expression ISO CHIC2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CHIC2 mRNA CTD PMID:33212167 Chic2 Rat arsane decreases ubiquitination ISO CHIC2 (Homo sapiens) 6480464 Arsenic results in decreased ubiquitination of CHIC2 protein CTD PMID:35994080 Chic2 Rat arsenic atom decreases ubiquitination ISO CHIC2 (Homo sapiens) 6480464 Arsenic results in decreased ubiquitination of CHIC2 protein CTD PMID:35994080 Chic2 Rat atrazine increases expression ISO CHIC2 (Homo sapiens) 6480464 Atrazine results in increased expression of CHIC2 mRNA CTD PMID:22378314 Chic2 Rat benzo[a]pyrene decreases expression ISO Chic2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CHIC2 mRNA CTD PMID:22228805 Chic2 Rat benzo[a]pyrene increases expression ISO CHIC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CHIC2 mRNA CTD PMID:21632981 Chic2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Chic2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CHIC2 mRNA CTD PMID:33754040 Chic2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CHIC2 mRNA CTD PMID:25181051 Chic2 Rat bisphenol A decreases expression ISO CHIC2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CHIC2 mRNA CTD PMID:29275510 Chic2 Rat bisphenol A affects expression ISO CHIC2 (Homo sapiens) 6480464 bisphenol A affects the expression of CHIC2 mRNA CTD PMID:30903817 Chic2 Rat bisphenol F multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CHIC2 mRNA CTD PMID:28628672 Chic2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of CHIC2 promoter CTD PMID:22457795 Chic2 Rat calcitriol increases expression ISO CHIC2 (Homo sapiens) 6480464 Calcitriol results in increased expression of CHIC2 mRNA CTD PMID:16002434 Chic2 Rat captan decreases expression ISO Chic2 (Mus musculus) 6480464 Captan results in decreased expression of CHIC2 mRNA CTD PMID:31558096 Chic2 Rat carbamazepine affects expression ISO CHIC2 (Homo sapiens) 6480464 Carbamazepine affects the expression of CHIC2 mRNA CTD PMID:25979313 Chic2 Rat carbon nanotube multiple interactions ISO Chic2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in decreased expression of CHIC2 mRNA CTD PMID:25926378 Chic2 Rat casticin decreases expression ISO Chic2 (Mus musculus) 6480464 casticin results in decreased expression of CHIC2 mRNA CTD PMID:28444820 Chic2 Rat chloropicrin increases expression ISO CHIC2 (Homo sapiens) 6480464 chloropicrin results in increased expression of CHIC2 mRNA CTD PMID:26352163 Chic2 Rat cisplatin multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CHIC2 mRNA CTD PMID:27392435 Chic2 Rat clofibrate decreases expression ISO Chic2 (Mus musculus) 6480464 Clofibrate results in decreased expression of CHIC2 mRNA CTD PMID:23811191 Chic2 Rat cobalt dichloride increases expression ISO CHIC2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CHIC2 mRNA CTD PMID:19376846 Chic2 Rat copper atom multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CHIC2 mRNA CTD PMID:20971185 Chic2 Rat copper(0) multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CHIC2 mRNA CTD PMID:20971185 Chic2 Rat copper(II) sulfate increases expression ISO CHIC2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CHIC2 mRNA CTD PMID:19549813 Chic2 Rat crocidolite asbestos increases expression ISO CHIC2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of CHIC2 mRNA CTD PMID:18687144 Chic2 Rat cyclosporin A increases expression ISO CHIC2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CHIC2 mRNA CTD PMID:20106945 more ... Chic2 Rat dexamethasone multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CHIC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CHIC2 mRNA CTD PMID:28628672 Chic2 Rat Dibutyl phosphate affects expression ISO CHIC2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CHIC2 mRNA CTD PMID:37042841 Chic2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CHIC2 mRNA CTD PMID:21266533 Chic2 Rat ethyl methanesulfonate increases expression ISO CHIC2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CHIC2 mRNA CTD PMID:23649840 Chic2 Rat fenthion increases expression ISO Chic2 (Mus musculus) 6480464 Fenthion results in increased expression of CHIC2 mRNA CTD PMID:34813904 Chic2 Rat fluoranthene multiple interactions ISO Chic2 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of CHIC2 mRNA CTD PMID:28329830 Chic2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CHIC2 mRNA CTD PMID:24793618 Chic2 Rat folic acid multiple interactions ISO Chic2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHIC2 mRNA CTD PMID:22206623 Chic2 Rat folic acid decreases expression ISO Chic2 (Mus musculus) 6480464 Folic Acid results in decreased expression of CHIC2 mRNA CTD PMID:25629700 Chic2 Rat formaldehyde increases expression ISO CHIC2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of CHIC2 mRNA CTD PMID:23649840 Chic2 Rat gentamycin increases expression ISO CHIC2 (Homo sapiens) 6480464 Gentamicins results in increased expression of CHIC2 mRNA CTD PMID:38447685 Chic2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CHIC2 mRNA CTD PMID:33387578 Chic2 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of CHIC2 promoter CTD PMID:23740543 Chic2 Rat hydrogen peroxide affects expression ISO CHIC2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CHIC2 mRNA CTD PMID:21179406 Chic2 Rat indometacin multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CHIC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of CHIC2 mRNA CTD PMID:28628672 Chic2 Rat methyl methanesulfonate increases expression ISO CHIC2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CHIC2 mRNA CTD PMID:23649840 Chic2 Rat mitomycin C affects response to substance ISO CHIC2 (Homo sapiens) 6480464 CHIC2 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Chic2 Rat ozone multiple interactions ISO CHIC2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CHIC2 mRNA CTD PMID:35430440 Chic2 Rat paracetamol affects expression ISO Chic2 (Mus musculus) 6480464 Acetaminophen affects the expression of CHIC2 mRNA CTD PMID:17562736 Chic2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CHIC2 mRNA CTD PMID:33387578 Chic2 Rat phenobarbital affects expression ISO CHIC2 (Homo sapiens) 6480464 Phenobarbital affects the expression of CHIC2 mRNA CTD PMID:19159669 Chic2 Rat potassium chromate decreases expression ISO CHIC2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CHIC2 mRNA CTD PMID:22714537 Chic2 Rat rac-lactic acid decreases expression ISO CHIC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CHIC2 mRNA CTD PMID:30851411 Chic2 Rat silver atom increases expression ISO CHIC2 (Homo sapiens) 6480464 Silver results in increased expression of CHIC2 mRNA CTD PMID:26014281 Chic2 Rat silver(0) increases expression ISO CHIC2 (Homo sapiens) 6480464 Silver results in increased expression of CHIC2 mRNA CTD PMID:26014281 Chic2 Rat sodium arsenite increases expression ISO CHIC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CHIC2 mRNA CTD PMID:38568856 Chic2 Rat tetrachloromethane increases expression ISO Chic2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CHIC2 mRNA CTD PMID:27339419 and PMID:31919559 Chic2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CHIC2 mRNA CTD PMID:34492290 Chic2 Rat thiram increases expression ISO CHIC2 (Homo sapiens) 6480464 Thiram results in increased expression of CHIC2 mRNA CTD PMID:38568856 Chic2 Rat titanium dioxide decreases methylation ISO Chic2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CHIC2 gene CTD PMID:35295148 Chic2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CHIC2 mRNA CTD PMID:33387578 Chic2 Rat triphenyl phosphate affects expression ISO CHIC2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CHIC2 mRNA CTD PMID:37042841 Chic2 Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of CHIC2 mRNA CTD PMID:36084822 Chic2 Rat urethane increases expression ISO CHIC2 (Homo sapiens) 6480464 Urethane results in increased expression of CHIC2 mRNA CTD PMID:28818685 Chic2 Rat valproic acid decreases methylation ISO CHIC2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CHIC2 gene CTD PMID:29154799 Chic2 Rat valproic acid increases expression ISO CHIC2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CHIC2 mRNA CTD PMID:23179753 and PMID:29154799
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) calcitriol (ISO) captan (ISO) carbamazepine (ISO) carbon nanotube (ISO) casticin (ISO) chloropicrin (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) ethyl methanesulfonate (ISO) fenthion (ISO) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP,ISO) hexane (EXP) hydrogen peroxide (ISO) indometacin (ISO) methyl methanesulfonate (ISO) mitomycin C (ISO) ozone (ISO) paracetamol (EXP,ISO) phenobarbital (ISO) potassium chromate (ISO) rac-lactic acid (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triticonazole (EXP) urethane (ISO) valproic acid (ISO)
Chic2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 33,511,839 - 33,546,181 (+) NCBI GRCr8 mRatBN7.2 14 33,157,669 - 33,192,015 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 33,157,537 - 33,191,895 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 33,507,861 - 33,542,251 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 34,815,670 - 34,849,824 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 33,300,926 - 33,335,318 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 35,683,657 - 35,718,005 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 35,683,442 - 35,717,922 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 35,512,033 - 35,546,381 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 35,522,470 - 35,558,067 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 35,499,310 - 35,557,069 (+) NCBI Celera 14 32,427,860 - 32,462,239 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
CHIC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 54,009,789 - 54,091,879 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 53,994,803 - 54,064,605 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 54,875,956 - 54,930,772 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 54,570,713 - 54,625,545 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 54,716,885 - 54,771,716 NCBI Celera 4 52,375,088 - 52,430,482 (-) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 50,822,904 - 50,877,817 (-) NCBI HuRef CHM1_1 4 54,911,655 - 54,966,517 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 57,497,038 - 57,579,148 (-) NCBI T2T-CHM13v2.0
Chic2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 75,165,665 - 75,205,302 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 75,158,649 - 75,205,435 (-) Ensembl GRCm39 Ensembl GRCm38 5 75,005,004 - 75,044,641 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 74,997,988 - 75,044,774 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 75,402,449 - 75,440,651 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 75,288,121 - 75,326,323 (-) NCBI MGSCv36 mm8 Celera 5 72,289,910 - 72,328,910 (-) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 39.54 NCBI
Chic2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 16,786,136 - 16,804,361 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 16,723,598 - 16,805,878 (+) NCBI ChiLan1.0 ChiLan1.0
CHIC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 75,725,640 - 75,785,464 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 75,934,039 - 76,019,672 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 69,875,762 - 69,933,360 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 76,435,107 - 76,490,712 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 76,435,107 - 76,490,371 (+) Ensembl panpan1.1 panPan2
CHIC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 46,558,657 - 46,606,226 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 46,560,009 - 46,607,959 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 46,512,630 - 46,564,868 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 47,165,483 - 47,217,744 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 47,169,583 - 47,217,685 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 46,838,016 - 46,890,246 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 46,370,185 - 46,422,417 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 47,243,242 - 47,295,476 (-) NCBI UU_Cfam_GSD_1.0
Chic2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 29,630,105 - 29,669,530 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 16,629,317 - 16,667,950 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 16,628,705 - 16,668,132 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CHIC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 40,780,889 - 40,846,577 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 40,781,365 - 40,846,715 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 42,834,328 - 42,889,022 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CHIC2
Chic2
.
Predicted Target Of
Count of predictions: 425 Count of miRNA genes: 238 Interacting mature miRNAs: 267 Transcripts: ENSRNOT00000003085 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003085 ⟹ ENSRNOP00000003085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 33,157,537 - 33,191,895 (+) Ensembl Rnor_6.0 Ensembl 14 35,683,442 - 35,717,922 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100515 ⟹ ENSRNOP00000085584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 33,157,537 - 33,190,923 (+) Ensembl
RefSeq Acc Id:
NM_001105736 ⟹ NP_001099206
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 33,511,839 - 33,546,181 (+) NCBI mRatBN7.2 14 33,157,669 - 33,192,015 (+) NCBI Rnor_6.0 14 35,683,657 - 35,718,005 (+) NCBI Rnor_5.0 14 35,512,033 - 35,546,381 (+) NCBI RGSC_v3.4 14 35,522,470 - 35,558,067 (+) RGD Celera 14 32,427,860 - 32,462,239 (+) NCBI
Sequence:
CGGCCGCCCTAGAGCCAGGGCCCCAGGCGGGGGGCTCGCCGGCGCGGGATGGCGGATTTCGATGAAATCTACGAGGAGGAGGAGGACGAGGAGCGGGCCCTGGAGGAACAGCTGCTCAAGTACTCGCC
hide sequence
RefSeq Acc Id:
NP_001099206 ⟸ NM_001105736
- UniProtKB:
G3V6A1 (UniProtKB/TrEMBL), A6JD10 (UniProtKB/TrEMBL), B6RGM6 (UniProtKB/TrEMBL)
- Sequence:
MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLRKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYH
hide sequence
Ensembl Acc Id:
ENSRNOP00000003085 ⟸ ENSRNOT00000003085
Ensembl Acc Id:
ENSRNOP00000085584 ⟸ ENSRNOT00000100515
RGD ID: 13699282 Promoter ID: EPDNEW_R9807 Type: initiation region Name: Chic2_1 Description: cysteine-rich hydrophobic domain 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 35,683,447 - 35,683,507 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Chic2
cysteine-rich hydrophobic domain 2
Chic2_predicted
cysteine-rich hydrophobic domain 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Chic2_predicted
cysteine-rich hydrophobic domain 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
