Advanced Search (OLGA)

Gene: Ptk6 (protein tyrosine kinase 6) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ptk6

Name:

protein tyrosine kinase 6

RGD ID:

1309098

Description:

Predicted to enable identical protein binding activity; non-membrane spanning protein tyrosine kinase activity; and signaling receptor binding activity. Predicted to be involved in several processes, including cellular response to retinoic acid; negative regulation of protein tyrosine kinase activity; and protein phosphorylation. Predicted to be located in cytosol; nuclear body; and ruffle. Predicted to be active in plasma membrane. Orthologous to human PTK6 (protein tyrosine kinase 6); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC366275; protein-tyrosine kinase 6; PTK6 protein tyrosine kinase 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PTK6 (protein tyrosine kinase 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ptk6 (PTK6 protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ptk6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PTK6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC102156300 (collagen alpha-4(IV) chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ptk6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PTK6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PTK6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ptk6 (protein tyrosine kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PTK6 (protein tyrosine kinase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ptk6 (PTK6 protein tyrosine kinase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ptk6b (PTK6 protein tyrosine kinase 6b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ptk6a (PTK6 protein tyrosine kinase 6a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	188,684,633 - 188,693,224 (-)	NCBI		GRCr8
mRatBN7.2	3	168,307,073 - 168,315,664 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	168,307,073 - 168,315,664 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	172,687,773 - 172,696,476 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	181,646,876 - 181,655,579 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	178,308,025 - 178,316,616 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	176,698,305 - 176,706,896 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	176,698,305 - 176,706,896 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	180,408,336 - 180,417,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	170,336,505 - 170,345,096 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	170,242,877 - 170,251,132 (-)	NCBI
Celera	3	164,270,220 - 164,278,811 (+)	NCBI		Celera
Cytogenetic Map	3	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptk6	Rat	autosomal dominant nocturnal frontal lobe epilepsy		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal dominant nocturnal frontal lobe epilepsy	ClinVar	PMID:24811917 more ...
Ptk6	Rat	autosomal recessive dyskeratosis congenita 5		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita and autosomal recessive 5	ClinVar	PMID:14534157 more ...
Ptk6	Rat	benign familial infantile seizures 6		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal dominant nocturnal frontal lobe epilepsy	ClinVar	PMID:24811917 more ...
Ptk6	Rat	developmental and epileptic encephalopathy		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:14534157 more ...
Ptk6	Rat	developmental and epileptic encephalopathy 33		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epileptic encephalopathy more ...	ClinVar	PMID:17290276 more ...
Ptk6	Rat	early infantile epileptic encephalopathy		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:14534157 more ...
Ptk6	Rat	keratoconus		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Keratoconus	ClinVar
Ptk6	Rat	neuronal ceroid lipofuscinosis		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neuronal ceroid lipofuscinosis	ClinVar	PMID:14534157 more ...
Ptk6	Rat	neuronal ceroid lipofuscinosis		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ceroid storage disease	ClinVar	PMID:19822871 more ...
Ptk6	Rat	Pulmonary Fibrosis and/or Bone Marrow Failure Syndrome, Telomere-Related, 3		ISO	PTK6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: PULMONARY FIBROSIS AND/OR BONE MARROW FAILURE SYNDROME more ...	ClinVar	PMID:14534157 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptk6	Rat	1,8-cineole	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Eucalyptol results in decreased expression of PTK6 mRNA	CTD	PMID:36331666
Ptk6	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of PTK6 mRNA	CTD	PMID:32145629
Ptk6	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	PTK6 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of PTK6 mRNA	CTD	PMID:23152189
Ptk6	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PTK6 mRNA	CTD	PMID:33387578
Ptk6	Rat	2-hydroxypropanoic acid	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PTK6 mRNA	CTD	PMID:30851411
Ptk6	Rat	Aflatoxin B2 alpha	increases methylation	ISO	PTK6 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of PTK6 intron	CTD	PMID:30157460
Ptk6	Rat	antirheumatic drug	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of PTK6 mRNA	CTD	PMID:24449571
Ptk6	Rat	arsenite(3-)	decreases methylation	ISO	PTK6 (Homo sapiens)	6480464	arsenite results in decreased methylation of PTK6 promoter	CTD	PMID:23974009
Ptk6	Rat	arsenous acid	decreases response to substance	ISO	PTK6 (Homo sapiens)	6480464	PTK6 protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Ptk6	Rat	benzene	increases expression	ISO	Ptk6 (Mus musculus)	6480464	Benzene results in increased expression of PTK6 mRNA	CTD	PMID:34624356
Ptk6	Rat	benzo[a]pyrene	decreases methylation	ISO	PTK6 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of PTK6 3' UTR	CTD	PMID:27901495
Ptk6	Rat	benzo[a]pyrene	increases methylation	ISO	PTK6 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of BRK promoter and Benzo(a)pyrene results in increased methylation of PTK6 promoter	CTD	PMID:27901495
Ptk6	Rat	beta-lapachone	increases expression	ISO	PTK6 (Homo sapiens)	6480464	beta-lapachone results in increased expression of PTK6 mRNA	CTD	PMID:38218311
Ptk6	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PTK6 mRNA	CTD	PMID:25181051
Ptk6	Rat	bisphenol A	multiple interactions	ISO	PTK6 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PTK6 gene	CTD	PMID:31601247
Ptk6	Rat	bisphenol A	increases methylation	ISO	Ptk6 (Mus musculus)	6480464	bisphenol A results in increased methylation of PTK6 promoter	CTD	PMID:27312807
Ptk6	Rat	diarsenic trioxide	decreases response to substance	ISO	PTK6 (Homo sapiens)	6480464	PTK6 protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Ptk6	Rat	folic acid	affects expression	ISO	PTK6 (Homo sapiens)	6480464	Folic Acid affects the expression of PTK6 mRNA	CTD	PMID:17320366
Ptk6	Rat	fulvestrant	multiple interactions	ISO	PTK6 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PTK6 gene	CTD	PMID:31601247
Ptk6	Rat	furan	decreases expression	EXP		6480464	furan results in decreased expression of PTK6 mRNA	CTD	PMID:25539665 and PMID:26194646
Ptk6	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PTK6 mRNA	CTD	PMID:22129741
Ptk6	Rat	lipopolysaccharide	decreases expression	ISO	Ptk6 (Mus musculus)	6480464	Lipopolysaccharides results in decreased expression of PTK6 mRNA	CTD	PMID:12057914
Ptk6	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PTK6 mRNA	CTD	PMID:22129741
Ptk6	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PTK6 mRNA	CTD	PMID:22129741
Ptk6	Rat	paclitaxel	increases expression	ISO	PTK6 (Homo sapiens)	6480464	Paclitaxel results in increased expression of PTK6 mRNA	CTD	PMID:15000894
Ptk6	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of PTK6 mRNA	CTD	PMID:30723492
Ptk6	Rat	phenformin	decreases expression	EXP		6480464	Phenformin results in decreased expression of PTK6 mRNA	CTD	PMID:31324951
Ptk6	Rat	ponatinib	decreases activity	ISO	PTK6 (Homo sapiens)	6480464	ponatinib results in decreased activity of PTK6 protein	CTD	PMID:19878872
Ptk6	Rat	rac-lactic acid	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PTK6 mRNA	CTD	PMID:30851411
Ptk6	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of PTK6 mRNA	CTD	PMID:28374803
Ptk6	Rat	rotenone	increases expression	ISO	Ptk6 (Mus musculus)	6480464	Rotenone results in increased expression of PTK6 mRNA	CTD	PMID:32937126
Ptk6	Rat	silicon dioxide	increases expression	ISO	PTK6 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of PTK6 mRNA	CTD	PMID:25895662
Ptk6	Rat	sodium arsenite	multiple interactions	ISO	PTK6 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of and affects the splicing of PTK6 mRNA	CTD	PMID:25879800
Ptk6	Rat	sodium fluoride	decreases expression	ISO	Ptk6 (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of PTK6 mRNA	CTD	PMID:27862939
Ptk6	Rat	sotorasib	multiple interactions	ISO	PTK6 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of PTK6 mRNA	CTD	PMID:36139627
Ptk6	Rat	tamoxifen	decreases expression	ISO	Ptk6 (Mus musculus)	6480464	Tamoxifen results in decreased expression of PTK6 mRNA	CTD	PMID:25123088
Ptk6	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of PTK6 mRNA	CTD	PMID:23411599
Ptk6	Rat	thioacetamide	affects expression	EXP		6480464	Thioacetamide affects the expression of PTK6 mRNA	CTD	PMID:34492290
Ptk6	Rat	trametinib	multiple interactions	ISO	PTK6 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of PTK6 mRNA	CTD	PMID:36139627
Ptk6	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PTK6 mRNA	CTD	PMID:33387578
Ptk6	Rat	triptonide	increases expression	ISO	Ptk6 (Mus musculus)	6480464	triptonide results in increased expression of PTK6 mRNA	CTD	PMID:33045310
Ptk6	Rat	tunicamycin	decreases expression	ISO	Ptk6 (Mus musculus)	6480464	Tunicamycin results in decreased expression of PTK6 mRNA	CTD	PMID:17127020
Ptk6	Rat	valproic acid	affects expression	ISO	Ptk6 (Mus musculus)	6480464	Valproic Acid affects the expression of PTK6 mRNA	CTD	PMID:17963808
Ptk6	Rat	valproic acid	increases methylation	ISO	PTK6 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PTK6 gene	CTD	PMID:29154799
Ptk6	Rat	vanadium atom	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Vanadium results in decreased expression of PTK6 mRNA	CTD	PMID:19000753
Ptk6	Rat	vanadium(0)	decreases expression	ISO	PTK6 (Homo sapiens)	6480464	Vanadium results in decreased expression of PTK6 mRNA	CTD	PMID:19000753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptk6	Rat	cell differentiation	involved_in	IBA	FB:FBgn0262733 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ptk6	Rat	cell migration	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:15572663	RGD	PMID:15572663
Ptk6	Rat	cell migration	involved_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	cell surface receptor protein tyrosine kinase signaling pathway	involved_in	IBA	PANTHER:PTN002521528 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ptk6	Rat	cellular response to retinoic acid	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:17910947	RGD	PMID:17910947
Ptk6	Rat	cellular response to retinoic acid	involved_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	intestinal epithelial cell differentiation	involved_in	ISO	Ptk6 (Mus musculus)	1624291	PMID:16782882	RGD	PMID:16782882
Ptk6	Rat	intestinal epithelial cell differentiation	involved_in	IEA	UniProtKB:Q64434 and ensembl:ENSMUSP00000016511	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	negative regulation of growth	involved_in	ISO	Ptk6 (Mus musculus)	1624291	PMID:16782882	RGD	PMID:16782882
Ptk6	Rat	negative regulation of growth	involved_in	IEA	UniProtKB:Q64434 and ensembl:ENSMUSP00000016511	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	negative regulation of protein tyrosine kinase activity	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:15539407	RGD	PMID:15539407
Ptk6	Rat	positive regulation of neuron projection development	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:17910947	RGD	PMID:17910947
Ptk6	Rat	positive regulation of neuron projection development	involved_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	protein autophosphorylation	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:12121988	RGD	PMID:12121988
Ptk6	Rat	tyrosine phosphorylation of STAT protein	involved_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:16568091 and PMID:17997837	RGD	PMID:16568091 and PMID:17997837

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptk6	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ptk6	Rat	cytoplasm	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	cytoplasm	located_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:15572663	RGD	PMID:15572663
Ptk6	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ptk6	Rat	cytosol	located_in	ISO	PTK6 (Homo sapiens) and UniProtKB:Q13882-1	1624291		RGD	GO_REF:0000052
Ptk6	Rat	cytosol	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	nuclear body	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	nuclear body	located_in	ISO	PTK6 (Homo sapiens) and UniProtKB:Q13882-1	1624291		RGD	GO_REF:0000052
Ptk6	Rat	nucleoplasm	located_in	ISO	PTK6 (Homo sapiens) and UniProtKB:Q13882-1	1624291		RGD	GO_REF:0000052
Ptk6	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	nucleus	located_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:10913193	RGD	PMID:10913193
Ptk6	Rat	nucleus	located_in	ISO	Ptk6 (Mus musculus)	1624291	PMID:12200423 and PMID:12833144	RGD	PMID:12200423 and PMID:12833144
Ptk6	Rat	nucleus	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	nucleus	located_in	IEA	UniProtKB:Q64434 and ensembl:ENSMUSP00000016511	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000017 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ptk6	Rat	plasma membrane	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	plasma membrane	located_in	ISO	PTK6 (Homo sapiens) and UniProtKB:Q13882-1	1624291		RGD	GO_REF:0000052
Ptk6	Rat	ruffle	located_in	ISO	PTK6 (Homo sapiens)	1624291	PMID:15572663	RGD	PMID:15572663
Ptk6	Rat	ruffle	located_in	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptk6	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ptk6	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ptk6	Rat	ATP binding	enables	IEA	InterPro:IPR000719 and InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ptk6	Rat	identical protein binding	enables	ISO	PTK6 (Homo sapiens)	1624291	UniProtKB:Q13882 more ...	RGD	PMID:15056653 more ...
Ptk6	Rat	identical protein binding	enables	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ptk6	Rat	non-membrane spanning protein tyrosine kinase activity	enables	ISO	PTK6 (Homo sapiens)	1624291	PMID:10913193	RGD	PMID:10913193
Ptk6	Rat	non-membrane spanning protein tyrosine kinase activity	enables	IEA	EC:2.7.10.2	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ptk6	Rat	non-membrane spanning protein tyrosine kinase activity	enables	IBA	FB:FBgn0262733 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ptk6	Rat	non-membrane spanning protein tyrosine kinase activity	enables	IEA	UniProtKB:Q13882 and ensembl:ENSP00000442460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ptk6	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ptk6	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ptk6	Rat	protein binding	enables	ISO	PTK6 (Homo sapiens)	1624291	UniProtKB:O00401 more ...	RGD	PMID:10913193 more ...
Ptk6	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ptk6	Rat	protein tyrosine kinase activity	enables	ISO	PTK6 (Homo sapiens)	1624291	PMID:16568091 more ...	RGD	PMID:16568091 more ...
Ptk6	Rat	protein tyrosine kinase activity	enables	IEA	UniProtKB-KW:KW-0829	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ptk6	Rat	protein tyrosine kinase activity	enables	IEA	ARBA:ARBA00027631	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ptk6	Rat	protein tyrosine kinase activity	enables	IEA	InterPro:IPR020635	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ptk6	Rat	signaling receptor binding	enables	IBA	FB:FBgn0262733 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ptk6	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10913193	PMID:12121988	PMID:12200423	PMID:12833144	PMID:15056653	PMID:15539407	PMID:15572663	PMID:16082217	PMID:16179349	PMID:16568091	PMID:16782882	PMID:17910947
PMID:17997837	PMID:18719096	PMID:18829532	PMID:19393627	PMID:19401189	PMID:20554524	PMID:20606012	PMID:22084245	PMID:25733683	PMID:26751287

Ptk6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	188,684,633 - 188,693,224 (-)	NCBI		GRCr8
mRatBN7.2	3	168,307,073 - 168,315,664 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	168,307,073 - 168,315,664 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	172,687,773 - 172,696,476 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	181,646,876 - 181,655,579 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	178,308,025 - 178,316,616 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	176,698,305 - 176,706,896 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	176,698,305 - 176,706,896 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	180,408,336 - 180,417,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	170,336,505 - 170,345,096 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	170,242,877 - 170,251,132 (-)	NCBI
Celera	3	164,270,220 - 164,278,811 (+)	NCBI		Celera
Cytogenetic Map	3	q43	NCBI

PTK6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	63,528,001 - 63,537,376 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	63,528,001 - 63,537,376 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	62,159,354 - 62,168,729 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	61,630,210 - 61,639,151 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	61,630,221 - 61,639,151	NCBI
Celera	20	58,840,123 - 58,849,063 (-)	NCBI		Celera
Cytogenetic Map	20	q13.33	NCBI
HuRef	20	58,889,971 - 58,898,928 (-)	NCBI		HuRef
CHM1_1	20	62,060,892 - 62,069,731 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	65,340,691 - 65,349,973 (-)	NCBI		T2T-CHM13v2.0

Ptk6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	180,836,917 - 180,845,408 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	180,835,514 - 180,844,582 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	181,195,124 - 181,202,789 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	181,193,721 - 181,202,789 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	180,929,829 - 180,937,494 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	181,124,531 - 181,132,196 (-)	NCBI		MGSCv36	mm8
Celera	2	185,277,943 - 185,285,608 (-)	NCBI		Celera
Cytogenetic Map	2	H4	NCBI
cM Map	2	103.62	NCBI

Ptk6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955528	687,996 - 695,596 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955528	687,996 - 695,596 (+)	NCBI	ChiLan1.0	ChiLan1.0

PTK6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	69,331,836 - 69,340,892 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	69,318,926 - 69,332,836 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	20	61,453,386 - 61,462,951 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	61,453,386 - 61,462,951 (-)	Ensembl	panpan1.1		panPan2

LOC102156300
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	47,124,847 - 47,132,516 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	46,324,188 - 46,330,708 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	48,094,349 - 48,100,872 (-)	NCBI		ROS_Cfam_1.0
UNSW_CanFamBas_1.0	24	47,234,634 - 47,241,155 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	47,972,659 - 47,979,186 (-)	NCBI		UU_Cfam_GSD_1.0

Ptk6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	195,371,493 - 195,380,130 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	10,826,724 - 10,832,954 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	10,826,013 - 10,833,170 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTK6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	62,538,855 - 62,546,870 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	62,538,853 - 62,547,866 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PTK6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	667,440 - 676,380 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	667,510 - 676,109 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	48,225,911 - 48,235,200 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptk6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	29,185,300 - 29,191,863 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	29,183,992 - 29,192,091 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ptk6
45 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	60
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000017337
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
1300161	Rf10	Renal function QTL 10	3.57		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	3	161192952	169034231	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	2	15	51	74	75	47	21	47	6	139	54	33	27	24	28


RefSeq Transcripts	NM_001108968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017337 ⟹ ENSRNOP00000017337

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	168,307,073 - 168,315,664 (-)	Ensembl
Rnor_6.0 Ensembl	3	176,698,305 - 176,706,896 (-)	Ensembl

RefSeq Acc Id:

NM_001108968 ⟹ NP_001102438

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	188,684,633 - 188,693,224 (-)	NCBI
mRatBN7.2	3	168,307,073 - 168,315,664 (-)	NCBI
Rnor_6.0	3	176,698,305 - 176,706,896 (-)	NCBI
Rnor_5.0	3	180,408,336 - 180,417,078 (-)	NCBI
RGSC_v3.4	3	170,336,505 - 170,345,096 (-)	RGD
Celera	3	164,270,220 - 164,278,811 (+)	RGD

Sequence:

show sequence

TCTGTGTAACTGTGGCTAGGTCTTGTCAAGGGGTTGTTTAGCTGACAGGCTTTCACCGAGTGTGAACACATAGCATGGTCTTATCCTGTAGATAAAAGAACAAACAGGGGCTAGAAGGGCCTTCAGGG
TGGAGCTAGGTTAGTCCATCTCCAATCAGTGCCGGGTGTGGCTGCTCTCCTGCCCATCATAAGGAAGTAGGTGTGACTGGCTTTCTGGGAAAAGTTCCTCCTACCTCTCCCAGCAGTAAGTGTCTACA
AGTAGGCCACAGTTGGCTCTGCCACTAAGCCTGCCATGGTGTCTTTGGACAAGGCTCACCTGGGTCCTAAGTATGTGGGCCTCTGGGACTTCAAAGCACGAACGGACGAGGAGCTGAGCTTTCAGGCA
GGAGACCTCCTCCATGTTACCAGGAAGGAGGAACAGTGGTGGTGGGCCACCCTGCTGGATGCGGAAGGCAAGGCCTTGGCTGAGGGCTACGTGCCCCACAACTACCTGGCTGAGAAGGAAACTGTGGA
GTCTGAACCGTGGTTCTTTGGTTGCATCTCCCGCTCAGAGGCCATGCACAGGCTGCAGTCTGAGGACTACCCGAAGGGTACCTTCCTGATCAGAGTCAGCCAGAAGCCAGGAGCAGACTATGTCCTCT
CCGTGTGGGATGCTGAGGCTGTTCGACATTACAGGATCTGGAGGAACAGTGCGGGCAGGCTGCACCTGAATGAGGTGGTATCCTTCTCCAGTCTGTCTGAGCTTGTGAACTACCACAAGACCCACAAC
CTGTCCCCTGGCCTACAGCTCTCCATGGCCTGCTGGAAGCTCAAAACTGAGCCCTTGCCCCACTGGGATGACTGGGAGAGGCCGAGGGAGGAGTTCACGCTCTGTAAGAAGCTGGGGTCTGGCTACTT
TGGGGAGGTCTTTGAAGGGCTCTGGAAAGGCCTGGTCCGTGTGGCTGTGAAGGTGATCTCTAGAGACAATCTCCTGCACCAGCACACCTTCCAGGCTGAGATTCAAGCCATGAAGAAGCTGCGACACA
AGCACATCCTGTCGCTGTACGCTGTGGCAACTGCAGGGGACCCAGTCTATATCATCACGGAGCTCATGCCCAAGGGGAGCCTGCTGCAGCTATTGCGGGACTCGGATGAGAAAGACCTGCCTATTTTG
GAACTGGTGGACTTTGCATCACAGGTTGCCGAGGGCATGTGCTACCTGGAATCTCAGAATTACATTCACCGTGACCTGGCTGCAAGGAACGTTCTCGTTACTGAGAACAATCTCTGCAAAGTGGGGGA
CTTTGGGCTGGCCAGGCTCGTCAAGGAGGACATCTACCTTTCCCGTGACCACAACGTCCCCTACAAATGGACAGCACCTGAGGCACTTTCCCGAGGGCATTACTCCATCAAATCGGATGTCTGGTCTT
TTGGTGTTCTCCTTCATGAAATTTTCAGCAGGGGGCAGATGCCCTACCCAGGCATGTCCAATCACGAAACCTTCCTGAGGGTGGATGCCGGCTACCGCATGCCCTGCCCCTTGGAGTGCCCACCCAAC
ATACACAAGCTGATGCTTAGCTGTTGGAGCAGAGACCCTAAGCAGAGACCCTGCTTCAAAGACCTGTGTGAGAAACTCTCAGGTATCACTAGGTATGAGAACCTGGTCTGAGCTCCTCGGCTGTGGCC
AGGACCCACAGAAGAGGGCCTCGTGGTTATCCTGGATTTCTACCGAAGGCATGCACCACCCTTCAGTTTACTGAGAAGAAGGGGTAGGGAACACACCAAACATATCTTAAACACTGAGTGTGGTCAAG
GAAAGAAAGAGGCAGCAGCCATGTTCCTTTCCCATTTATCCTCCTCCAGGAGGCAGTACACAAAATCCAGGAAGTCACTCTCTGGCTTCCTCATCCCTTCTCGCAAGACTTCATGTGACGGAGAAGCC
AAGAAGAGTCTAGGCAATAGTCTTTGTGGAATTCTTGCCATATCACTTTTAGAGCTTGACTGCCCACAAACACATAGCCCACCCATTAGTGCCTTAATTCTGCAGGATCTTATGCCACGTAAAACTCA
GAAGAAGTTTGCATGATTTTCTCTTTATAACCTTGGCTTCGCTGGAGGAGTCTCGCCTAGGAAGCTCAAGACAGATAAAATGATATGAAATTTC

hide sequence


Protein RefSeqs	NP_001102438	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL88742	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017337
	ENSRNOP00000017337.4

RefSeq Acc Id:

NP_001102438 ⟸ NM_001108968

- UniProtKB:

D3ZDS3 (UniProtKB/TrEMBL), A6KM34 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVSLDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTRKEEQWWWATLLDAEGKALAEGYVPHNYLAEKETVESEPWFFGCISRSEAMHRLQSEDYPKGTFLIRVSQKPGADYVLSVWDAEAVRHYR
IWRNSAGRLHLNEVVSFSSLSELVNYHKTHNLSPGLQLSMACWKLKTEPLPHWDDWERPREEFTLCKKLGSGYFGEVFEGLWKGLVRVAVKVISRDNLLHQHTFQAEIQAMKKLRHKHILSLYAVATA
GDPVYIITELMPKGSLLQLLRDSDEKDLPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKEDIYLSRDHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRG
QMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKLSGITRYENLV

hide sequence

Ensembl Acc Id:

ENSRNOP00000017337 ⟸ ENSRNOT00000017337

Protein Domains

Protein kinase SH2 SH3

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZDS3-F1-model_v2	AlphaFold	D3ZDS3	1-451	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-46302	BioCyc
Ensembl Genes	ENSRNOG00000012987	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017337	ENTREZGENE
	ENSRNOT00000017337.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.505.10	UniProtKB/TrEMBL
	Phosphorylase Kinase, domain 1	UniProtKB/TrEMBL
	SH3 Domains	UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/TrEMBL
InterPro	Kinase-like_dom	UniProtKB/TrEMBL
	Non-receptor_tyrosine_kinases	UniProtKB/TrEMBL
	Prot_kinase_cat_dom	UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/TrEMBL
	PTK6_SH2	UniProtKB/TrEMBL
	Ser-Thr/Tyr-Pkinase	UniProtKB/TrEMBL
	SH2	UniProtKB/TrEMBL
	SH2_dom_sf	UniProtKB/TrEMBL
	SH3-like_dom	UniProtKB/TrEMBL
	SH3_domain	UniProtKB/TrEMBL
	Tyr_Pkinase_cat_dom	UniProtKB/TrEMBL
	Tyr_prot_kinase_AS	UniProtKB/TrEMBL
KEGG Report	rno:366275	UniProtKB/TrEMBL
NCBI Gene	366275	ENTREZGENE
PANTHER	TYROSINE-PROTEIN KINASE	UniProtKB/TrEMBL
Pfam	Pkinase_Tyr	UniProtKB/TrEMBL
	SH2	UniProtKB/TrEMBL
	SH3_1	UniProtKB/TrEMBL
PhenoGen	Ptk6	PhenoGen
PRINTS	SH2DOMAIN	UniProtKB/TrEMBL
	SH3DOMAIN	UniProtKB/TrEMBL
	TYRKINASE	UniProtKB/TrEMBL
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/TrEMBL
	PROTEIN_KINASE_TYR	UniProtKB/TrEMBL
	SH2	UniProtKB/TrEMBL
	SH3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012987	RatGTEx
SMART	SH2	UniProtKB/TrEMBL
	SH3	UniProtKB/TrEMBL
	TyrKc	UniProtKB/TrEMBL
Superfamily-SCOP	Kinase_like	UniProtKB/TrEMBL
	SH3	UniProtKB/TrEMBL
	SSF55550	UniProtKB/TrEMBL
UniProt	A6KM34	ENTREZGENE, UniProtKB/TrEMBL
	D3ZDS3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-02-28	Ptk6	protein tyrosine kinase 6	Ptk6	PTK6 protein tyrosine kinase 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ptk6	PTK6 protein tyrosine kinase 6	Ptk6_predicted	PTK6 protein tyrosine kinase 6 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ptk6_predicted	PTK6 protein tyrosine kinase 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar