Advanced Search (OLGA)

Gene: Ribc2 (RIB43A domain with coiled-coils 2) Rattus norvegicus

Analyze

Symbol:

Ribc2

Name:

RIB43A domain with coiled-coils 2

RGD ID:

1309033

Description:

Predicted to be involved in flagellated sperm motility. Predicted to be located in axonemal microtubule. Predicted to be active in axonemal A tubule inner sheath and sperm flagellum. Orthologous to human RIBC2 (RIB43A domain with coiled-coils 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC300122; RGD1309033; RIB43A-like with coiled-coils protein 2; similar to hypothetical protein MGC4107

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RIBC2 (RIB43A domain with coiled-coils 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Ribc2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ribc2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RIBC2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RIBC2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ribc2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RIBC2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RIBC2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ribc2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ribc2 (RIB43A domain with coiled-coils 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RIBC2 (RIB43A domain with coiled-coils 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ribc2 (RIB43A domain with coiled-coils 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ribc2 (RIB43A domain with coiled-coils 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7264	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ribc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ribc2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	118,122,722 - 118,137,772 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	118,122,408 - 118,137,767 (+)	Ensembl				GRCr8
mRatBN7.2	7	116,242,863 - 116,257,868 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	116,242,863 - 116,257,863 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	117,993,721 - 118,008,723 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	120,219,457 - 120,234,459 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	120,188,896 - 120,203,898 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	126,028,371 - 126,043,371 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	126,028,350 - 126,043,847 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	125,742,589 - 125,757,589 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	123,140,197 - 123,155,197 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	112,541,028 - 112,556,028 (+)	NCBI		Celera
RGSC_v3.1	7	123,174,426 - 123,189,427 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

Cuprizon (EXP)

D-glucose (ISO)

dioxygen (ISO)

endosulfan (ISO)

fructose (ISO)

glucose (ISO)

glyphosate (ISO)

GSK-J4 (ISO)

iron dichloride (ISO)

lead nitrate (EXP)

Licochalcone B (ISO)

menadione (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

titanium dioxide (ISO)

trametinib (ISO)

urethane (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

flagellated sperm motility (ISO,ISS)

Cellular Component

axonemal A tubule inner sheath (ISO,ISS)

axonemal microtubule (IEA,ISO,ISS)

axoneme (IEA)

sperm flagellum (ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:19103603	PMID:21630459

Genomics

Comparative Map Data

Ribc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	118,122,722 - 118,137,772 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	118,122,408 - 118,137,767 (+)	Ensembl				GRCr8
mRatBN7.2	7	116,242,863 - 116,257,868 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	116,242,863 - 116,257,863 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	117,993,721 - 118,008,723 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	120,219,457 - 120,234,459 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	120,188,896 - 120,203,898 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	126,028,371 - 126,043,371 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	126,028,350 - 126,043,847 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	125,742,589 - 125,757,589 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	123,140,197 - 123,155,197 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	112,541,028 - 112,556,028 (+)	NCBI		Celera
RGSC_v3.1	7	123,174,426 - 123,189,427 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

RIBC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	45,413,693 - 45,432,509 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	45,413,693 - 45,432,509 (+)	Ensembl			hg38	GRCh38
GRCh37	22	45,809,574 - 45,828,389 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	44,188,244 - 44,206,966 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	44,130,116 - 44,148,839	NCBI
Celera	22	29,720,957 - 29,739,621 (+)	NCBI		Celera
Cytogenetic Map	22	q13.31	NCBI
HuRef	22	28,755,687 - 28,774,418 (+)	NCBI		HuRef
CHM1_1	22	45,768,294 - 45,787,025 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	45,898,580 - 45,917,342 (+)	NCBI		T2T-CHM13v2.0

Ribc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	85,016,261 - 85,028,771 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	85,016,279 - 85,028,771 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	85,132,060 - 85,144,570 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	85,132,078 - 85,144,570 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	84,962,529 - 84,974,999 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	84,959,844 - 84,972,336 (+)	NCBI		MGSCv36	mm8
Celera	15	87,264,622 - 87,277,097 (+)	NCBI		Celera
Cytogenetic Map	15	E2	NCBI
cM Map	15	40.25	NCBI

Ribc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	29,764,684 - 29,783,711 (+)	Ensembl
ChiLan1.0	NW_004955413	29,765,119 - 29,781,206 (+)	NCBI	ChiLan1.0	ChiLan1.0

RIBC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	55,235,551 - 55,288,350 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	57,934,687 - 57,987,034 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	26,299,646 - 26,335,700 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	44,479,585 - 44,501,197 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	44,479,585 - 44,501,197 (+)	Ensembl			panPan2	panpan1.1

RIBC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	20,625,423 - 20,640,266 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	20,625,447 - 20,640,468 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	20,545,847 - 20,561,082 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	21,359,636 - 21,374,874 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	21,359,660 - 21,374,771 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	21,078,309 - 21,093,539 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	21,392,181 - 21,407,385 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	21,572,266 - 21,587,501 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ribc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	4,301,677 - 4,315,267 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936629	4,301,746 - 4,315,133 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936629	4,301,746 - 4,315,133 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RIBC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	3,966,440 - 3,975,830 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	3,966,339 - 3,976,024 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	1,200,140 - 1,209,854 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RIBC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	27,879,777 - 27,900,198 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	27,879,972 - 27,900,659 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	97,434,840 - 97,455,649 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ribc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	4,238,457 - 4,255,537 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	4,241,679 - 4,255,776 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ribc2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	254,502,512 - 254,517,948 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ribc2
176 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	92
Count of miRNA genes:	79
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000042412
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	116269196	132020414	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
8	4	13	112	27	37	11	12	11	2	93	31	3	104	39	92	26	7	7

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000042412 ⟹ ENSRNOP00000041528

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	118,122,408 - 118,137,767 (+)	Ensembl
mRatBN7.2 Ensembl	7	116,242,863 - 116,257,863 (+)	Ensembl
Rnor_6.0 Ensembl	7	126,028,350 - 126,043,847 (+)	Ensembl

RefSeq Acc Id:

NM_001013949 ⟹ NP_001013971

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	118,122,767 - 118,137,767 (+)	NCBI
mRatBN7.2	7	116,242,863 - 116,257,863 (+)	NCBI
Rnor_6.0	7	126,028,371 - 126,043,371 (+)	NCBI
Rnor_5.0	7	125,742,589 - 125,757,589 (+)	NCBI
RGSC_v3.4	7	123,140,197 - 123,155,197 (+)	RGD
Celera	7	112,541,028 - 112,556,028 (+)	RGD

Sequence:

show sequence

GATTCCTGCGCCACAAAGATCGTTGCGGAAAGCGGACTGCCTGTGTCCGCTGGGACAGACTTGC
TCTCAAACTTTTGTGGGCGCTGCTTCTCGGCGCTGTAGCTTATTTCTGTGGGCTTTTCTTACCG
TGTTTGTTCAGAAAGCCCCTGAAGCCTTGCCAAACTCCAGAGCCATGGAGGTAGCAATTCCTAA
AGACCTACAACAGGAGGCCAGCCTAGCCAAGAAGCGGTACATGGACCTGTGCAGGCAGGGACAG
ATCTTCGACGCCAGAAACAGGATCATTGGGGGAGACACACAAGCCTGGGATGTTCAAGTTCGTA
ACCAGAAGATAAAAGAAGTAACTGAAAAAGCTAGGGATGAAACCTTTGCTGCCGAAATGAGGCA
CAATGACAAAGTCATGTGCATAATGCATGACCGGGAACTGAGGCACAGGAAGCAGCTATGTAGA
GCTATCAATGACTTCCAGCAGCGTTTTCAGAAGCCAGAAACTCGCCGTGAATTTGATCTTTCTG
ACCCCCTGGCCCTTAAGAAAGAGCTTCCAGCCCGGGTTTCAGACAATGACATGCGGAACACCAT
ATCAGGCATGCAGAAGTTCATGGGGGAGGATTTAAACTTCCAAGAGAGGAAGAGAATCCAGAAG
GAACAGAACCGAGAATGGTCTCTGCAGCAGCACGGGGAATGGGAGCGAGCCCAGGCTGAACACA
AACTGGCAGAACACCTCCACACACAGACGGAACTAAAGTTTGATGAAGCAGCCAGAGACTTGCA
GAGGCTGGAAATCACCACCAGGAAGGCAGTCTGCGCAGCAGTGAAAGAGTTCAACAAGAAACAG
GTTGTGGAGTTGGCAGAAAGGAAGAGGCAAGTGAAACAACAAGAACAAGAGGATAACATGAGCG
AGATCACCAACCTGCTGCATGGGGACCTACTCTCTGAGAACCCTCAGCAGGCAGCCAGCAACTT
TGGACCTCGCCATGTGATGCTTGACCGCTGGAAGGGCATGAACCGGGAGCAGTTGGAGGAGATC
TGGTCAACATGGAAGCAGCAAATCCATGAGAAACTGAGGCTTCAGGAGGAAGAGCGCCAGCACA
ACATGGACTGGGACCTGCGCAGGACCCGGAAGGCTCATGCCAGCCTGCTGCAGGAGCGACAACA
GCAGCGTTTGTTGCGGGAACAGCGCAGGGCCTTGGACTGCAGCAACCTCAGCCTGGCCAAGCAG
CAGTATTTACAGAAAAGACAATTGGATGCAGCCCCCTCAAGTCAACCCACAGAAGACTATTTCT
CACAGTTTAATACAAGAAGCCGCTAATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078851 ⟹ XP_038934779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	118,122,722 - 118,137,772 (+)	NCBI
mRatBN7.2	7	116,242,886 - 116,257,868 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013971	(Get FASTA)	NCBI Sequence Viewer
	XP_038934779	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79434	(Get FASTA)	NCBI Sequence Viewer
	EDM15587	(Get FASTA)	NCBI Sequence Viewer
	EDM15588	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000041528.4
GenBank Protein	Q6AXN9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013971 ⟸ NM_001013949

- UniProtKB:

Q6AXN9 (UniProtKB/Swiss-Prot), R9PXY2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVAIPKDLQQEASLAKKRYMDLCRQGQIFDARNRIIGGDTQAWDVQVRNQKIKEVTEKARDET
FAAEMRHNDKVMCIMHDRELRHRKQLCRAINDFQQRFQKPETRREFDLSDPLALKKELPARVSD
NDMRNTISGMQKFMGEDLNFQERKRIQKEQNREWSLQQHGEWERAQAEHKLAEHLHTQTELKFD
EAARDLQRLEITTRKAVCAAVKEFNKKQVVELAERKRQVKQQEQEDNMSEITNLLHGDLLSENP
QQAASNFGPRHVMLDRWKGMNREQLEEIWSTWKQQIHEKLRLQEEERQHNMDWDLRRTRKAHAS
LLQERQQQRLLREQRRALDCSNLSLAKQQYLQKRQLDAAPSSQPTEDYFSQFNTRSR

hide sequence

Ensembl Acc Id:

ENSRNOP00000041528 ⟸ ENSRNOT00000042412

RefSeq Acc Id:	XP_038934779 ⟸ XM_039078851
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXN9-F1-model_v2	AlphaFold	Q6AXN9	1-377	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695564

Promoter ID:

EPDNEW_R6089

Type:

initiation region

Name:

Ribc2_1

Description:

RIB43A domain with coiled-coils 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	126,028,383 - 126,028,443	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309033	AgrOrtholog
BioCyc Gene	G2FUF-32561	BioCyc
Ensembl Genes	ENSRNOG00000033502	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000042412.6	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7115185	IMAGE-MGC_LOAD
InterPro	RIB43A	UniProtKB/Swiss-Prot
KEGG Report	rno:300122	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94981	IMAGE-MGC_LOAD
NCBI Gene	300122	ENTREZGENE
PANTHER	PTHR14517	UniProtKB/Swiss-Prot
	RIB43A-LIKE WITH COILED-COILS PROTEIN 2	UniProtKB/Swiss-Prot
Pfam	RIB43A	UniProtKB/Swiss-Prot
PhenoGen	Ribc2	PhenoGen
RatGTEx	ENSRNOG00000033502	RatGTEx
UniProt	A6HTD5_RAT	UniProtKB/TrEMBL
	Q6AXN9	ENTREZGENE
	R9PXY2	ENTREZGENE
	RIBC2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	R9PXY2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Ribc2	RIB43A domain with coiled-coils 2	RGD1309033	similar to hypothetical protein MGC4107	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1309033	similar to hypothetical protein MGC4107	RGD1309033_predicted	similar to hypothetical protein MGC4107 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309033_predicted	similar to hypothetical protein MGC4107 (predicted)	LOC300122_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC300122_predicted	similar to hypothetical protein MGC4107 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD