Symbol:
Hltf
Name:
helicase-like transcription factor
RGD ID:
1309031
Description:
Predicted to enable ATP-dependent activity, acting on DNA; ubiquitin protein ligase activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including mRNA transcription by RNA polymerase II; positive regulation of transcription by RNA polymerase II; and regulation of neurogenesis. Predicted to be located in nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Orthologous to human HLTF (helicase like transcription factor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC295568; Smarca3; Snf2l3; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 104,478,725 - 104,538,531 (+) NCBI GRCr8 mRatBN7.2 2 102,549,724 - 102,609,492 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 102,549,724 - 102,609,327 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 109,063,231 - 109,122,470 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 107,184,391 - 107,243,629 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 102,148,291 - 102,207,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 104,854,571 - 104,914,338 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 104,854,572 - 104,914,173 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 105,202,487 - 105,262,107 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 105,148,839 - 105,205,382 (+) NCBI Celera 2 97,919,578 - 97,979,241 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hltf Rat (-)-epigallocatechin 3-gallate multiple interactions ISO HLTF (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of HLTF mRNA CTD PMID:22079256 Hltf Rat (S)-nicotine decreases expression ISO HLTF (Homo sapiens) 6480464 Nicotine results in decreased expression of HLTF mRNA CTD PMID:18247414 Hltf Rat 1,2-dimethylhydrazine increases expression ISO Hltf (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HLTF mRNA CTD PMID:22206623 Hltf Rat 17beta-estradiol decreases expression ISO Hltf (Mus musculus) 6480464 Estradiol results in decreased expression of HLTF mRNA CTD PMID:39298647 Hltf Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Hltf (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Hltf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO HLTF (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of HLTF mRNA CTD PMID:22574217 Hltf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HLTF mRNA CTD PMID:34747641 Hltf Rat 2-methylcholine affects expression ISO HLTF (Homo sapiens) 6480464 beta-methylcholine affects the expression of HLTF mRNA CTD PMID:21179406 Hltf Rat 2-naphthylamine decreases expression ISO HLTF (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of HLTF mRNA CTD PMID:18247414 Hltf Rat 2-palmitoylglycerol increases expression ISO HLTF (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of HLTF mRNA CTD PMID:37199045 Hltf Rat 4-hydroxyphenyl retinamide decreases expression ISO Hltf (Mus musculus) 6480464 Fenretinide results in decreased expression of HLTF mRNA CTD PMID:28973697 Hltf Rat 5-aza-2'-deoxycytidine affects methylation ISO HLTF (Homo sapiens) 6480464 Decitabine affects the methylation of HLTF promoter CTD PMID:17571247 Hltf Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of HLTF mRNA CTD PMID:31881176 Hltf Rat aflatoxin B1 increases expression ISO Hltf (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of HLTF mRNA CTD PMID:19770486 Hltf Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of HLTF mRNA CTD PMID:23630614 Hltf Rat all-trans-retinoic acid decreases expression ISO Hltf (Mus musculus) 6480464 Tretinoin results in decreased expression of HLTF mRNA CTD PMID:16604517 Hltf Rat all-trans-retinoic acid decreases expression ISO HLTF (Homo sapiens) 6480464 Tretinoin results in decreased expression of HLTF mRNA CTD PMID:33167477 Hltf Rat antimonite multiple interactions ISO HLTF (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of HLTF mRNA CTD PMID:32076005 Hltf Rat antirheumatic drug increases expression ISO HLTF (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of HLTF mRNA CTD PMID:24449571 Hltf Rat aristolochic acid A decreases expression ISO HLTF (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HLTF mRNA CTD PMID:33212167 Hltf Rat arsane multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat arsenic atom multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat arsenite(3-) multiple interactions ISO HLTF (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to HLTF mRNA] CTD PMID:32406909 Hltf Rat benzo[a]pyrene decreases expression ISO HLTF (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HLTF mRNA CTD PMID:18247414 Hltf Rat benzo[a]pyrene affects methylation ISO HLTF (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HLTF promoter CTD PMID:27901495 Hltf Rat benzo[a]pyrene increases expression ISO HLTF (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HLTF protein CTD PMID:32717239 Hltf Rat bisphenol A decreases expression ISO Hltf (Mus musculus) 6480464 bisphenol A results in decreased expression of HLTF mRNA CTD PMID:26063408 Hltf Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HLTF mRNA CTD PMID:34947998 Hltf Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HLTF mRNA CTD PMID:25181051 more ... Hltf Rat caffeine increases phosphorylation ISO HLTF (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of HLTF protein CTD PMID:35688186 Hltf Rat CGP 52608 multiple interactions ISO HLTF (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HLTF gene] CTD PMID:28238834 Hltf Rat cyclosporin A decreases expression ISO HLTF (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HLTF mRNA CTD PMID:20106945 and PMID:25562108 Hltf Rat Dibutyl phosphate affects expression ISO HLTF (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HLTF mRNA CTD PMID:37042841 Hltf Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of HLTF mRNA CTD PMID:21266533 Hltf Rat dibutyl phthalate decreases expression ISO Hltf (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of HLTF mRNA CTD PMID:21266533 Hltf Rat dicrotophos decreases expression ISO HLTF (Homo sapiens) 6480464 dicrotophos results in decreased expression of HLTF mRNA CTD PMID:28302478 Hltf Rat dioxygen multiple interactions ISO Hltf (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HLTF mRNA CTD PMID:30529165 Hltf Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO HLTF (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of HLTF mRNA CTD PMID:32076005 Hltf Rat epoxiconazole increases expression ISO Hltf (Mus musculus) 6480464 epoxiconazole results in increased expression of HLTF mRNA CTD PMID:35436446 Hltf Rat folic acid decreases expression ISO Hltf (Mus musculus) 6480464 Folic Acid results in decreased expression of HLTF mRNA CTD PMID:25629700 Hltf Rat FR900359 affects phosphorylation ISO HLTF (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HLTF protein CTD PMID:37730182 Hltf Rat furan increases expression EXP 6480464 furan results in increased expression of HLTF mRNA CTD PMID:25539665 Hltf Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of HLTF mRNA CTD PMID:22129741 Hltf Rat ivermectin decreases expression ISO HLTF (Homo sapiens) 6480464 Ivermectin results in decreased expression of HLTF protein CTD PMID:32959892 Hltf Rat Lasiocarpine multiple interactions ISO HLTF (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of HLTF mRNA CTD PMID:33884520 Hltf Rat manganese atom multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat manganese(0) multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat manganese(II) chloride multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat methyl methanesulfonate increases expression ISO HLTF (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of HLTF mRNA CTD PMID:23649840 Hltf Rat motexafin gadolinium decreases expression ISO HLTF (Homo sapiens) 6480464 motexafin gadolinium results in decreased expression of HLTF mRNA CTD PMID:16357179 Hltf Rat motexafin gadolinium multiple interactions ISO HLTF (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of HLTF mRNA CTD PMID:16357179 Hltf Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of HLTF mRNA CTD PMID:22129741 Hltf Rat nickel atom decreases expression ISO HLTF (Homo sapiens) 6480464 Nickel results in decreased expression of HLTF mRNA CTD PMID:23195993 Hltf Rat nicotine decreases expression ISO HLTF (Homo sapiens) 6480464 Nicotine results in decreased expression of HLTF mRNA CTD PMID:18247414 Hltf Rat oxybenzone increases expression ISO HLTF (Homo sapiens) 6480464 oxybenzone results in increased expression of HLTF mRNA CTD PMID:36581016 Hltf Rat paracetamol increases expression ISO Hltf (Mus musculus) 6480464 Acetaminophen results in increased expression of HLTF mRNA CTD PMID:17585979 Hltf Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HLTF mRNA CTD PMID:33387578 Hltf Rat paracetamol decreases expression ISO HLTF (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HLTF mRNA CTD PMID:21420995 Hltf Rat perfluorooctane-1-sulfonic acid decreases expression ISO HLTF (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of HLTF mRNA CTD PMID:27153767 Hltf Rat perfluorooctanoic acid decreases expression ISO HLTF (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of HLTF protein CTD PMID:26879310 Hltf Rat pirinixic acid decreases expression ISO Hltf (Mus musculus) 6480464 pirinixic acid results in decreased expression of HLTF mRNA CTD PMID:20813756 Hltf Rat potassium chromate multiple interactions ISO HLTF (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of HLTF mRNA CTD PMID:22079256 Hltf Rat potassium chromate decreases expression ISO HLTF (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of HLTF mRNA CTD PMID:22079256 Hltf Rat potassium dichromate decreases expression ISO Hltf (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of HLTF mRNA CTD PMID:23608068 Hltf Rat quercetin decreases expression ISO HLTF (Homo sapiens) 6480464 Quercetin results in decreased expression of HLTF mRNA CTD PMID:21632981 Hltf Rat resveratrol multiple interactions ISO HLTF (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HLTF mRNA CTD PMID:23557933 Hltf Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HLTF mRNA CTD PMID:28374803 Hltf Rat sodium arsenite multiple interactions ISO HLTF (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HLTF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of HLTF mRNA CTD PMID:39836092 Hltf Rat testosterone decreases expression ISO HLTF (Homo sapiens) 6480464 Testosterone results in decreased expression of HLTF mRNA CTD PMID:33359661 Hltf Rat thapsigargin increases expression ISO Hltf (Mus musculus) 6480464 Thapsigargin results in increased expression of HLTF protein CTD PMID:24648495 Hltf Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HLTF mRNA CTD PMID:23411599 and PMID:34492290 Hltf Rat titanium dioxide increases methylation ISO Hltf (Mus musculus) 6480464 titanium dioxide results in increased methylation of HLTF gene CTD PMID:35295148 Hltf Rat triphenyl phosphate affects expression ISO HLTF (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HLTF mRNA CTD PMID:37042841 Hltf Rat trovafloxacin decreases expression ISO Hltf (Mus musculus) 6480464 trovafloxacin results in decreased expression of HLTF mRNA CTD PMID:35537566 Hltf Rat valproic acid decreases expression ISO HLTF (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HLTF mRNA CTD PMID:23179753 Hltf Rat valproic acid increases expression ISO HLTF (Homo sapiens) 6480464 Valproic Acid results in increased expression of HLTF mRNA CTD PMID:28001369 and PMID:29154799 Hltf Rat valproic acid affects expression ISO HLTF (Homo sapiens) 6480464 Valproic Acid affects the expression of HLTF mRNA CTD PMID:25979313 Hltf Rat zinc acetate multiple interactions ISO HLTF (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of HLTF mRNA CTD PMID:16357179 Hltf Rat zinc acetate decreases expression ISO HLTF (Homo sapiens) 6480464 Zinc Acetate results in decreased expression of HLTF mRNA CTD PMID:16357179
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 2-naphthylamine (ISO) 2-palmitoylglycerol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) antimonite (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) epoxiconazole (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) indole-3-methanol (EXP) ivermectin (ISO) Lasiocarpine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methyl methanesulfonate (ISO) motexafin gadolinium (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nicotine (ISO) oxybenzone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenite (ISO) testosterone (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO) zinc acetate (ISO)
Hltf Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 104,478,725 - 104,538,531 (+) NCBI GRCr8 mRatBN7.2 2 102,549,724 - 102,609,492 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 102,549,724 - 102,609,327 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 109,063,231 - 109,122,470 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 107,184,391 - 107,243,629 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 102,148,291 - 102,207,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 104,854,571 - 104,914,338 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 104,854,572 - 104,914,173 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 105,202,487 - 105,262,107 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 105,148,839 - 105,205,382 (+) NCBI Celera 2 97,919,578 - 97,979,241 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
HLTF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 149,030,063 - 149,086,533 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 149,030,127 - 149,086,554 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 148,747,850 - 148,804,320 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 150,230,594 - 150,287,031 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 150,230,611 - 150,287,015 NCBI Celera 3 147,158,179 - 147,214,609 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI HuRef 3 146,119,870 - 146,176,257 (-) NCBI HuRef CHM1_1 3 148,710,947 - 148,767,418 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 151,780,777 - 151,837,250 (-) NCBI T2T-CHM13v2.0
Hltf Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 20,111,959 - 20,172,655 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 20,111,975 - 20,172,654 (+) Ensembl GRCm39 Ensembl GRCm38 3 20,057,808 - 20,118,491 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 20,057,811 - 20,118,490 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 19,957,811 - 20,018,376 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 20,249,962 - 20,310,527 (+) NCBI MGSCv36 mm8 Celera 3 20,047,166 - 20,107,713 (+) NCBI Celera Cytogenetic Map 3 A2 NCBI cM Map 3 6.15 NCBI
Hltf Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 8,412,136 - 8,486,752 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 8,411,912 - 8,488,938 (+) NCBI ChiLan1.0 ChiLan1.0
HLTF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 146,925,896 - 146,982,742 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 146,930,616 - 146,987,472 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 146,054,371 - 146,111,150 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 153,632,319 - 153,688,951 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 153,632,319 - 153,688,951 (-) Ensembl panpan1.1 panPan2
HLTF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 43,868,896 - 43,918,616 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 43,870,939 - 43,918,436 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 43,734,282 - 43,783,354 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 44,498,185 - 44,547,255 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 44,498,189 - 44,547,213 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 44,086,465 - 44,136,026 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 44,134,925 - 44,184,505 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 44,389,026 - 44,438,712 (-) NCBI UU_Cfam_GSD_1.0
Hltf Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 83,155,157 - 83,202,437 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936519 6,531,571 - 6,582,081 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936519 6,531,549 - 6,579,724 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HLTF Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 89,261,205 - 89,333,011 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 89,261,199 - 89,333,020 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 97,254,690 - 97,326,863 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HLTF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 41,621,349 - 41,676,185 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 41,621,456 - 41,674,120 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 14,463,704 - 14,518,550 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hltf
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
2
102561518
102561519
G
C
snv
ACI/EurMcwi (2019) , ACI/N (2020), F344/DuCrl (2019), F344/NCrl (2019), F344/N (2020), F344/Stm (2019), FXLE16/Stm (2020), FXLE18/Stm (2020), LEXF11/Stm (2020), LEXF1A/Stm (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), LEXF4/Stm (2020), LE/Stm (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), LEXF10A/StmMcwi (2020), M520/NRrrcMcwi (2019), M520/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WN/N (2020), ACI/EurMcwi (2019NG), BUF/MnaMcwi (2022), F344/DuCrl (2019NG), F344/DuCrl (2019NG), F344/DuCrl (2021), European Variation Archive Release 3, European Variation Archive Release 4, LEXF2A/StmMcwi (2023), FXLE26/StmMcwi (2023), FXLE22/StmMcwi (2023), FXLE20/StmMcwi (2023), LEXF8D/StmMcwi (2023), FXLE23/StmMcwi (2023), LEXF10C/StmMcwi (2023), FXLE17/StmMcwi (2023), LEXF6B/StmMcwi (2023), FXLE15/StmMcwi (2023), FXLE14/StmMcwi (2023), FXLE21/StmMcwi (2023), FXLE13/StmMcwi (2023), LEXF5/StmMcwi (2023), FXLE25/StmMcwi (2023), FXLE12/StmMcwi (2023), European Variation Archive Release 6, F344/NHsd (2021), F344/StmMcwi (2019), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE13/Stm (2019NG), FXLE14/Stm (2019NG), FXLE15/StmMcwi (2021), FXLE15/Stm (2019NG), FXLE17/Stm (2019NG), FXLE19/StmMcwi (2022), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE25/Stm (2022), FXLE26/Stm (2022), LEXF10B/StmMcwi (2022), LEXF10C/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF2C/StmMcwi (2022), LEXF5/Stm (2019NG), LEXF6B/Stm (2019NG), LEXF7A/Stm (2019NG), LEXF7B/StmMcwi (2022), LEXF7C/StmMcwi (2022), LEXF8A/StmMcwi (2021), LEXF8D/Stm (2022), LEXF9/StmMcwi (2022), M520/NRrrcMcwi (2019NG), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), RCS/LavRrrcMcwi (2021), SS/HsdMcwiCrl (2021), SS/JrHsdMcwi (2019NG), SS/JrHsd (2021) View more Information
Assembly: Rnor_5.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
2
124586344
124586345
G
C
snv
ACI/EurMcwi (MCW) , ZFDM (KyushuU), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), LH/MavRrrc (KNAW), LL/MavRrrc (KNAW), LN/MavRrrc (KNAW), MHS/Gib (KNAW), MR/N (KNAW), SR/JrHsd (KNAW), SS/Jr (KNAW), SS/JrHsdMcwi (KNAW), ACI/N (KNAW), ACI/EurMcwi (KNAW), SBN/Ygl (KNAW), F344/NRrrc (Illumina) (KNAW), F344/NRrrc (SOLiD) (KNAW), F344/NCrl (KNAW), F344/NHsd (KNAW), LE/Stm (Illumina) (KNAW), LE/Stm (SOLiD) (KNAW), M520/N (KNAW), WN/N (KNAW), LE/OrlBarth (UDEL), IS/Kyo (KyushuU), BUF/MNa (KyushuU), NIG-III/Hok (KyushuU), F344/DuCrlCrlj (KyushuU), LE/Stm (KyushuU), F344/NSlc (KyushuU), RCS/Kyo (KyushuU), IS-Tlk/Kyo (KyushuU), F344/Stm (KyushuU), HWY/Slc (KyushuU), F344/Jcl (KyushuU), KFRS3B/Kyo (KyushuU), ZF (KyushuU), SBN/Ygl (MCW) View more Information
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
2
104866368
104866369
G
C
snv
ACI/EurMcwi (MCW) , European Variation Archive Release 6, SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), ACI/N (MCW), F344/NRrrc (MCW), M520/N (MCW), MR/N (MCW), WN/N (MCW), ACI/EurMcwi (RGD), F344/NCrl (RGD), LE/Stm (RGD), LH/MavRrrc (RGD), LN/MavRrrc (RGD), LL/MavRrrc (RGD), MHS/Gib (RGD), SBN/Ygl (RGD), SR/JrHsd (RGD), SS/Jr (RGD), SS/JrHsdMcwi (RGD), ACI/EurMcwi (2019), ACI/N (2020), F344/DuCrl (2019), F344/NCrl (2019), F344/N (2020), F344/Stm (2019), FXLE16/Stm (2020), FXLE18/Stm (2020), LEXF11/Stm (2020), LEXF1A/Stm (2019), LEXF1C/Stm (2019), LEXF2B/Stm (2019), LEXF3/Stm (2020), LEXF4/Stm (2020), LE/Stm (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), LEXF10A/StmMcwi (2020), M520/NRrrcMcwi (2019), M520/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WN/N (2020), European Variation Archive Release 3, European Variation Archive Release 4, SBN/Ygl (MCW) View more Information
Predicted Target Of
Count of predictions: 414 Count of miRNA genes: 241 Interacting mature miRNAs: 293 Transcripts: ENSRNOT00000064828 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578777 Stresp15 Stress response QTL 15 2 0.05 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 2 59846005 104846005 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61465 Bp13 Blood pressure QTL 13 3.3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 76539322 102785628 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 5684990 Bmd82 Bone mineral density QTL 82 2.8 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 2 59324377 103795077 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 7411551 Bw131 Body weight QTL 131 29.6 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 67942638 112942638 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 631500 Bp99 Blood pressure QTL 99 2.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 59324719 102755241 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 5684996 Bmd85 Bone mineral density QTL 85 4.7 0.024 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 2 59324377 103795077 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306903 Bp336 Blood pressure QTL 336 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 64366971 109366971 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH127313
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 102,608,853 - 102,609,044 (+) MAPPER mRatBN7.2 Rnor_6.0 2 104,913,700 - 104,913,890 NCBI Rnor6.0 Rnor_5.0 2 124,633,751 - 124,633,941 UniSTS Rnor5.0 RGSC_v3.4 2 105,261,622 - 105,261,812 UniSTS RGSC3.4 Celera 2 97,978,756 - 97,978,946 UniSTS RH 3.4 Map 2 729.6 UniSTS Cytogenetic Map 2 q24 UniSTS
AU047370
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 102,560,975 - 102,561,122 (+) MAPPER mRatBN7.2 Rnor_6.0 2 104,865,822 - 104,865,972 NCBI Rnor6.0 Rnor_5.0 2 124,585,798 - 124,585,948 UniSTS Rnor5.0 RGSC_v3.4 2 105,213,737 - 105,213,887 UniSTS RGSC3.4 Celera 2 97,930,809 - 97,930,973 UniSTS Cytogenetic Map 2 q24 UniSTS
RH140388
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 116,967,420 - 116,967,609 (+) MAPPER mRatBN7.2 mRatBN7.2 2 102,609,025 - 102,609,211 (+) MAPPER mRatBN7.2 Rnor_6.0 2 104,913,872 - 104,914,057 NCBI Rnor6.0 Rnor_6.0 6 121,687,222 - 121,687,410 NCBI Rnor6.0 Rnor_5.0 6 130,907,420 - 130,907,608 UniSTS Rnor5.0 Rnor_5.0 2 124,633,923 - 124,634,108 UniSTS Rnor5.0 RGSC_v3.4 6 121,856,966 - 121,857,154 UniSTS RGSC3.4 RGSC_v3.4 2 105,261,794 - 105,261,979 UniSTS RGSC3.4 Celera 2 97,978,928 - 97,979,113 UniSTS Celera 6 114,547,864 - 114,548,052 UniSTS Cytogenetic Map 2 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064828 ⟹ ENSRNOP00000060341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 102,549,724 - 102,609,327 (+) Ensembl Rnor_6.0 Ensembl 2 104,854,572 - 104,914,173 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090912 ⟹ ENSRNOP00000069487
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 102,549,724 - 102,609,327 (+) Ensembl Rnor_6.0 Ensembl 2 104,854,580 - 104,912,627 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106667 ⟹ ENSRNOP00000092944
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 102,549,724 - 102,609,327 (+) Ensembl
RefSeq Acc Id:
NM_001106478 ⟹ NP_001099948
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,478,765 - 104,538,378 (+) NCBI mRatBN7.2 2 102,549,724 - 102,609,339 (+) NCBI Rnor_6.0 2 104,854,572 - 104,914,185 (+) NCBI Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI RGSC_v3.4 2 105,202,487 - 105,262,107 (+) RGD Celera 2 97,919,578 - 97,979,241 (+) RGD
Sequence:
TCCTCACATTGTTGCAGGAAGGAGTGGGCGTAGACATGTCTCCCGGGGAGCTTGTGGCCTCCAGATTCTGACTTGCTTTCCGGCCCCTGGGCCGCTACACCTTGAGGAGCTTTTTCAGACGGTCTGAG
hide sequence
RefSeq Acc Id:
XM_006232175 ⟹ XP_006232237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,478,725 - 104,538,531 (+) NCBI mRatBN7.2 2 102,549,734 - 102,609,492 (+) NCBI Rnor_6.0 2 104,854,571 - 104,914,338 (+) NCBI Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI
Sequence:
TTCCTCACATTGTTGCAGGAAGGAGTGGGCGTAGACATGTCTCCCGGGGAGCTTGTGGCCTCCA
hide sequence
RefSeq Acc Id:
XM_006232176 ⟹ XP_006232238
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,478,725 - 104,538,531 (+) NCBI mRatBN7.2 2 102,549,734 - 102,609,492 (+) NCBI Rnor_6.0 2 104,854,572 - 104,914,338 (+) NCBI Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI
Sequence:
TCCTCACATTGTTGCAGGAAGGAGTGGGCGTAGACATGTCTCCCGGGGAGCTTGTGGCCTCCAG
hide sequence
RefSeq Acc Id:
XM_006232177 ⟹ XP_006232239
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,478,775 - 104,538,531 (+) NCBI mRatBN7.2 2 102,549,734 - 102,609,492 (+) NCBI Rnor_6.0 2 104,854,571 - 104,914,338 (+) NCBI Rnor_5.0 2 124,574,548 - 124,634,389 (+) NCBI
Sequence:
TTCCTCACATTGTTGCAGGAAGGAGTGGGCGTAGACATGTCTCCCGGGGAGCTTGTGGCCTCCAGATTCTGACTTGCTTTCCGGCCCCTGGGCCGCTACACCTTGAGGAGCTTTTTCAGACGGTCTGA
hide sequence
RefSeq Acc Id:
XM_039102120 ⟹ XP_038958048
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 104,478,775 - 104,538,531 (+) NCBI mRatBN7.2 2 102,549,734 - 102,609,492 (+) NCBI
RefSeq Acc Id:
NP_001099948 ⟸ NM_001106478
- UniProtKB:
D3ZMQ9 (UniProtKB/TrEMBL), A6IHC7 (UniProtKB/TrEMBL)
- Sequence:
MSWKFKRDSVWKYSQSAQYGAHENIPRLSYPPFFPRFEFQDIIPPDDFQTSDEELDLVLFGTMRGQVVGIRYYTGVVNNNEMVALEREPNNPYDKNAIKVNNVNGNQVGHLKRDLAAALAYIMDNKLA
hide sequence
RefSeq Acc Id:
XP_006232237 ⟸ XM_006232175
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AF43 (UniProtKB/TrEMBL)
- Sequence:
MSWKFKRDSVWKYSQSAQYGAHENIPRLSYPPFFPRFEFQDIIPPDDFQTSDEELDLVLFGTMRGQVVGIRYYTGVVNNNEMVALEREPNNPYDKNAIKVNNVNGNQVGHLKRDLAAALAYIMDNKLA
hide sequence
RefSeq Acc Id:
XP_006232239 ⟸ XM_006232177
- Peptide Label:
isoform X3
- Sequence:
MSWKFKRDSVWKYSQSAQYGAHENIPRLSYPPFFPRFEFQDIIPPDDFQTSDEELDLVLFGTMRGQVVGIRYYTGVVNNNEMVALEREPNNPYDKNAIKVNNVNGNQVGHLKRDLAAALAYIMDNKLA
hide sequence
RefSeq Acc Id:
XP_006232238 ⟸ XM_006232176
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2JVH5 (UniProtKB/TrEMBL)
- Sequence:
MSWKFKRDSVWKYSQSAQYGAHENIPRLSYPPFFPRFEFQDIIPPDDFQTSDEELDLVLFGTMRGQVVGIRYYTGVVNNNEMVALEREPNNPYDKNAIKVNNVNGNQVGHLKRDLAAALAYIMDNKLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000069487 ⟸ ENSRNOT00000090912
Ensembl Acc Id:
ENSRNOP00000060341 ⟸ ENSRNOT00000064828
RefSeq Acc Id:
XP_038958048 ⟸ XM_039102120
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000092944 ⟸ ENSRNOT00000106667
RGD ID: 13691262 Promoter ID: EPDNEW_R1782 Type: initiation region Name: Hltf_1 Description: helicase-like transcription factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 104,854,601 - 104,854,661 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Hltf
helicase-like transcription factor
Smarca3_predicted
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Smarca3_predicted
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
