Advanced Search (OLGA)

Gene: Samd7 (sterile alpha motif domain containing 7) Rattus norvegicus

Analyze

Symbol:

Samd7

Name:

sterile alpha motif domain containing 7

RGD ID:

1308931

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific; chromatin binding activity; and histone binding activity. Predicted to be involved in negative regulation of DNA-templated transcription; negative regulation of gene expression, epigenetic; and retinal rod cell development. Predicted to be located in cytoplasm. Predicted to be part of PRC1 complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in macular degeneration. Orthologous to human SAMD7 (sterile alpha motif domain containing 7); INTERACTS WITH bisphenol A; glyphosate; aflatoxin B1 (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC310257; sterile alpha motif domain-containing protein 7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,551,633 - 114,572,774 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	114,551,640 - 114,572,774 (-)	Ensembl				GRCr8
mRatBN7.2	2	112,623,135 - 112,644,269 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,624,942 - 112,639,549 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	119,279,504 - 119,294,104 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,392,066 - 117,406,670 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,101,741 - 112,116,348 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	113,924,292 - 113,945,425 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	113,983,236 - 114,004,367 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	113,848,025 - 113,869,154 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	113,654,910 - 113,676,045 (-)	NCBI		F344_StmMcwi
Rnor_6.0	2	116,239,812 - 116,269,769 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,243,373 - 116,257,980 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	135,937,567 - 135,956,889 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	117,042,946 - 117,057,553 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	107,805,859 - 107,820,484 (-)	NCBI		Celera
RGSC_v3.1	2	116,987,907 - 117,030,046 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

macular degeneration (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

glyphosate (EXP)

perfluorononanoic acid (ISO)

permethrin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of DNA-templated transcription (IBA)

negative regulation of gene expression (IEA,ISO)

negative regulation of gene expression, epigenetic (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA)

retinal rod cell development (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

PRC1 complex (IEA,ISO)

Molecular Function

chromatin binding (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

histone binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:23565263

Genomics

Comparative Map Data

Samd7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,551,633 - 114,572,774 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	114,551,640 - 114,572,774 (-)	Ensembl				GRCr8
mRatBN7.2	2	112,623,135 - 112,644,269 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,624,942 - 112,639,549 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	119,279,504 - 119,294,104 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,392,066 - 117,406,670 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,101,741 - 112,116,348 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	113,924,292 - 113,945,425 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	113,983,236 - 114,004,367 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	113,848,025 - 113,869,154 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	113,654,910 - 113,676,045 (-)	NCBI		F344_StmMcwi
Rnor_6.0	2	116,239,812 - 116,269,769 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,243,373 - 116,257,980 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	135,937,567 - 135,956,889 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	117,042,946 - 117,057,553 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	107,805,859 - 107,820,484 (-)	NCBI		Celera
RGSC_v3.1	2	116,987,907 - 117,030,046 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

SAMD7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	169,911,572 - 169,939,175 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	169,911,572 - 169,939,175 (+)	Ensembl			hg38	GRCh38
GRCh37	3	169,629,360 - 169,656,963 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	171,112,176 - 171,139,645 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	171,112,183 - 171,139,648	NCBI
Celera	3	168,028,781 - 168,056,256 (+)	NCBI		Celera
Cytogenetic Map	3	q26.2	NCBI
HuRef	3	166,999,640 - 167,027,127 (+)	NCBI		HuRef
CHM1_1	3	169,592,474 - 169,619,958 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	172,695,837 - 172,723,459 (+)	NCBI		T2T-CHM13v2.0

Samd7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	30,800,481 - 30,821,323 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	30,800,442 - 30,821,323 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	30,746,293 - 30,767,174 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	30,746,293 - 30,767,174 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	30,645,215 - 30,666,096 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	30,937,131 - 30,958,004 (+)	NCBI		MGSCv36	mm8
Celera	3	30,658,778 - 30,679,490 (+)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	14.27	NCBI

Samd7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	161,353 - 177,936 (+)	Ensembl
ChiLan1.0	NW_004955420	161,353 - 178,768 (+)	NCBI	ChiLan1.0	ChiLan1.0

SAMD7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	167,801,511 - 167,834,050 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	167,806,234 - 167,838,773 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	166,914,164 - 166,952,937 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	174,980,176 - 175,007,430 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	174,980,176 - 175,007,421 (+)	Ensembl			panPan2	panpan1.1

SAMD7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	34,518,133 - 34,537,516 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	34,518,757 - 34,537,480 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	43,532,118 - 43,550,972 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	34,599,067 - 34,617,818 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	34,599,067 - 34,617,804 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	34,545,475 - 34,564,323 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	34,512,483 - 34,531,344 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	34,777,382 - 34,796,257 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Samd7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	101,121,415 - 101,146,389 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936593	2,472,946 - 2,500,604 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936593	2,475,199 - 2,500,593 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SAMD7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	108,610,172 - 108,642,120 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	108,622,402 - 108,641,412 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	117,367,917 - 117,386,607 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SAMD7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	19,457,823 - 19,486,250 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	19,458,474 - 19,477,487 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	28,263,859 - 28,291,341 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Samd7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	47,963,819 - 47,992,910 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	47,963,819 - 47,992,869 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Samd7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	124,981,475 - 124,996,193 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Samd7
255 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	74
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000033449
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	104957381	149957381	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	114032149	150226270	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
2	9	2	58	102	11	11	3	38	2	6	164	107	5	96	47	48	9	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006232225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000033449 ⟹ ENSRNOP00000030145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	114,551,640 - 114,572,774 (-)	Ensembl
mRatBN7.2 Ensembl	2	112,624,942 - 112,639,549 (-)	Ensembl
Rnor_6.0 Ensembl	2	116,243,373 - 116,257,980 (-)	Ensembl

RefSeq Acc Id:

NM_001191703 ⟹ NP_001178632

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	114,551,640 - 114,572,774 (-)	NCBI
mRatBN7.2	2	112,623,135 - 112,644,269 (-)	NCBI
Dahl_SR_JrHsd	2	113,924,292 - 113,945,425 (-)	NCBI
Lyon_Normotensive	2	113,983,236 - 114,004,367 (-)	NCBI
Lyon_Hypertensive	2	113,848,025 - 113,869,154 (-)	NCBI
F344_StmMcwi	2	113,654,910 - 113,676,045 (-)	NCBI
Rnor_6.0	2	116,243,373 - 116,257,980 (-)	NCBI
Rnor_5.0	2	135,937,567 - 135,956,889 (-)	NCBI
Celera	2	107,805,859 - 107,820,484 (-)	NCBI

Sequence:

show sequence

ATGGCAAACCCAATGATGTCGGTGAACTCTTTACTGACAGCAGGACCACAGAGGGTCTCAATGG
TTCCCTCGCCATTTGGGCCTCCAATTGGGGACAGAGATGCCTTGCCTTCCACTATAGCTCCAAC
TGACCCAAGCCAATTTTGTGTTCCTTCCCAATTTGGATCCTCTGGTCTCCCAAGTGCAAATACG
CCAAACCCACTGCCGGGTCACTTCTACTCAGGCTGGGGTATTTTACCACCTGAACCCATAAAGG
CAGTGACCACAAGGAATGAGATGTTTGAAAGACATCACGCTGCCAGGGCAGAAATGGAAATGTA
TTCTCTTTACCAGCAACGTAGAATGGAAAGAGTCAATCCCAAAGGACTCTCTGGTCTGGGGATA
CCACTCTTCTATGGGTCAGGTTGTCTGGGTGGCCCCGCAGGTTTCCAGGGCAGGAGCACACTGC
CAGCCAGTGATGTGCATGTGCACAGAAGCACCTTCAGACACCTTCAGGGAAACCCTGTTCTGCT
AGCAACTAGACCACACTTTACAGAGTGCTGGGGCCAGAAATACCGACTCAGGAGAGGTACCGTT
TACCAGAAGCCTCCAGAGATTGACACTGAGAGTTTCAAAAGTCAAGCAGACGAGAAAAGCTCAG
GCCAGATGCCCACGGCTCCCTATGAAGAGGAAGAGTATATCAAAGACCCAGAAATTGGGGTAGA
CAATCAGCAGGAGCCAAGGGTCACTGATGGAAACCCAACTGCGGTCCTCGCCAACCCCCATGGA
GAACCCCAGCCAAACCAGAGAAAACCCTCTTCCATGGAGGCCAAGGCATGGGATGATGGGAAGG
GAGAGCCCTCCGAGCAGGGCTATGAAGGCTGTGATGAAAAGAATGGAGTTTGCCTGCCAGCCTC
CACCCTGCCTCTGCCAGGAACACAGGAGCCAGTTGCACTTCAGGAAAACCGTCCTTTGTCTGAT
ATTCACAAGTGGACGGTGGATGATGTGTATAACTTCATCAGAAGTCTTCCAGGCTGCTCAGACT
ATGCCCAGGTCTTTAAGGACCACGCGATTGATGGAGAAACACTGCCCCTTCTTACAGAACAGCA
TCTTCGAGGCACCATGGGACTCAAGCTGGGCCCAGCACTGAAAATTCAGTCTCAGGTATCTCAG
CATGTGGGAAATATGTTCTGTAAAAAACTTCCTTCACTTCCCTCCCATGCAAGGCAAGCATTTG
ATCAGCCAGCAGACACATCCCCTCTTTTGGCTATTGGTTCCTGGAGAGATGGATTGAGCATTCC
TGGTTCCCAGGACATAATGAGTCCAGAAAGAGCTGAACAAGACGTTATGAGAAATTAA

hide sequence

RefSeq Acc Id:

XM_063281760 ⟹ XP_063137830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	114,551,633 - 114,568,631 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178632	(Get FASTA)	NCBI Sequence Viewer
	XP_063137830	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030145
	ENSRNOP00000030145.4

RefSeq Acc Id:

NP_001178632 ⟸ NM_001191703

- UniProtKB:

D4A5C9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MANPMMSVNSLLTAGPQRVSMVPSPFGPPIGDRDALPSTIAPTDPSQFCVPSQFGSSGLPSANT
PNPLPGHFYSGWGILPPEPIKAVTTRNEMFERHHAARAEMEMYSLYQQRRMERVNPKGLSGLGI
PLFYGSGCLGGPAGFQGRSTLPASDVHVHRSTFRHLQGNPVLLATRPHFTECWGQKYRLRRGTV
YQKPPEIDTESFKSQADEKSSGQMPTAPYEEEEYIKDPEIGVDNQQEPRVTDGNPTAVLANPHG
EPQPNQRKPSSMEAKAWDDGKGEPSEQGYEGCDEKNGVCLPASTLPLPGTQEPVALQENRPLSD
IHKWTVDDVYNFIRSLPGCSDYAQVFKDHAIDGETLPLLTEQHLRGTMGLKLGPALKIQSQVSQ
HVGNMFCKKLPSLPSHARQAFDQPADTSPLLAIGSWRDGLSIPGSQDIMSPERAEQDVMRN

hide sequence

Ensembl Acc Id:

ENSRNOP00000030145 ⟸ ENSRNOT00000033449

RefSeq Acc Id:	XP_063137830 ⟸ XM_063281760
- Peptide Label:	isoform X1
- UniProtKB:	D4A5C9 (UniProtKB/TrEMBL)

Protein Domains

SAM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5C9-F1-model_v2	AlphaFold	D4A5C9	1-445	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308931	AgrOrtholog
BioCyc Gene	G2FUF-53461	BioCyc
Ensembl Genes	ENSRNOG00000027995	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033449	ENTREZGENE
	ENSRNOT00000033449.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.150.50	UniProtKB/TrEMBL
InterPro	PcG_chromatin_remod_factors	UniProtKB/TrEMBL
	SAM	UniProtKB/TrEMBL
	SAM_type	UniProtKB/TrEMBL
KEGG Report	rno:310257	UniProtKB/TrEMBL
NCBI Gene	310257	ENTREZGENE
PANTHER	POLYCOMB GROUP PROTEIN	UniProtKB/TrEMBL
	STERILE ALPHA MOTIF DOMAIN-CONTAINING PROTEIN 7	UniProtKB/TrEMBL
Pfam	SAM_1	UniProtKB/TrEMBL
PhenoGen	Samd7	PhenoGen
PROSITE	SAM_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027995	RatGTEx
SMART	SAM	UniProtKB/TrEMBL
Superfamily-SCOP	SAM_homology	UniProtKB/TrEMBL
UniProt	D4A5C9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Samd7	sterile alpha motif domain containing 7	Samd7_predicted	sterile alpha motif domain containing 7 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Samd7_predicted	sterile alpha motif domain containing 7 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM