Advanced Search (OLGA)

Gene: Ripply3 (ripply transcriptional repressor 3) Rattus norvegicus

Analyze

Symbol:

Ripply3

Name:

ripply transcriptional repressor 3

RGD ID:

1308788

Description:

Predicted to be involved in several processes, including embryonic pattern specification; negative regulation of transcription by RNA polymerase II; and pharyngeal system development. Predicted to act upstream of or within negative regulation of cell population proliferation. Predicted to be active in nucleus. Orthologous to human RIPPLY3 (ripply transcriptional repressor 3); INTERACTS WITH 1,3-dinitrobenzene; 6-propyl-2-thiouracil; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Down syndrome critical region gene 6; Down syndrome critical region homolog 6; Down syndrome critical region homolog 6 (human); Dscr6; LOC288239; ripply3 homolog; ripply3 homolog (zebrafish)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	47,118,147 - 47,126,244 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	47,118,147 - 47,131,954 (+)	Ensembl				GRCr8
mRatBN7.2	11	33,648,471 - 33,656,587 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	33,648,486 - 33,656,584 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	42,303,306 - 42,311,405 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	34,974,670 - 34,982,769 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	34,123,066 - 34,131,163 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	34,557,679 - 34,565,776 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	34,557,679 - 34,565,776 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	38,145,428 - 38,153,525 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	34,575,083 - 34,583,180 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	34,793,208 - 34,801,305 (-)	NCBI		Celera
RGSC_v3.1	11	34,631,403 - 34,639,055 (+)	NCBI
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

etoposide (ISO)

fenvalerate (EXP)

fipronil (EXP)

folic acid (ISO)

fulvestrant (ISO)

inulin (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

methimazole (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetraphene (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

embryonic pattern specification (IBA)

heart development (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of transcription by RNA polymerase II (IBA,ISO)

pharyngeal system development (ISO)

Cellular Component

nucleus (IBA,IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:21177346	PMID:25053427

Genomics

Comparative Map Data

Ripply3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	47,118,147 - 47,126,244 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	47,118,147 - 47,131,954 (+)	Ensembl				GRCr8
mRatBN7.2	11	33,648,471 - 33,656,587 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	33,648,486 - 33,656,584 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	42,303,306 - 42,311,405 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	34,974,670 - 34,982,769 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	34,123,066 - 34,131,163 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	34,557,679 - 34,565,776 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	34,557,679 - 34,565,776 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	38,145,428 - 38,153,525 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	34,575,083 - 34,583,180 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	34,793,208 - 34,801,305 (-)	NCBI		Celera
RGSC_v3.1	11	34,631,403 - 34,639,055 (+)	NCBI
Cytogenetic Map	11	q11	NCBI

RIPPLY3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	37,006,150 - 37,019,662 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	37,006,150 - 37,019,662 (+)	Ensembl			hg38	GRCh38
GRCh37	21	38,378,450 - 38,391,962 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	37,300,733 - 37,313,829 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	21	37,300,732 - 37,313,826	NCBI
Celera	21	23,577,251 - 23,590,347 (+)	NCBI		Celera
Cytogenetic Map	21	q22.13	NCBI
HuRef	21	23,854,553 - 23,867,647 (+)	NCBI		HuRef
CHM1_1	21	37,940,236 - 37,953,313 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	21	35,388,362 - 35,401,872 (+)	NCBI		T2T-CHM13v2.0

Ripply3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	94,129,281 - 94,137,794 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	94,129,279 - 94,137,794 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	94,328,422 - 94,336,935 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	94,328,420 - 94,336,935 (+)	Ensembl			mm10	GRCm38
MGSCv37	16	94,550,029 - 94,558,542 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	94,437,218 - 94,445,733 (+)	NCBI		MGSCv36	mm8
Celera	16	95,415,747 - 95,424,097 (+)	NCBI		Celera
Cytogenetic Map	16	C4	NCBI
cM Map	16	55.17	NCBI

Ripply3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	36,105,474 - 36,108,889 (+)	Ensembl
ChiLan1.0	NW_004955407	36,101,206 - 36,108,808 (+)	NCBI	ChiLan1.0	ChiLan1.0

RIPPLY3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	33,118,522 - 33,130,950 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	27,979,071 - 27,991,153 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	23,368,472 - 23,379,560 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	36,723,931 - 36,734,886 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	36,723,931 - 36,734,382 (+)	Ensembl			panPan2	panpan1.1

RIPPLY3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	32,150,768 - 32,188,604 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	32,150,882 - 32,188,436 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	31,239,163 - 31,249,248 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	31,481,096 - 31,491,184 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	31,481,116 - 31,506,328 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	31,349,063 - 31,359,184 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	31,362,083 - 31,372,228 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	31,852,602 - 31,862,690 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

RIPPLY3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	200,642,802 - 200,652,401 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	210,717,930 - 210,727,520 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RIPPLY3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	80,992,876 - 81,001,956 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666054	8,835,299 - 8,847,263 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ripply3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624745	26,636,307 - 26,658,373 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ripply3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	50,301,905 - 50,309,852 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ripply3
62 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	92
Interacting mature miRNAs:	108
Transcripts:	ENSRNOT00000002289
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	3818154	48818154	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	10806125	55806125	Rat
634341	Bw121	Body weight QTL 121	3.56		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	11	35323199	55805892	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	29958996	57754989	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
2290451	Scl58	Serum cholesterol level QTL 58	3.48		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	11	26318031	55806125	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1600394	Edcs1	Endometrial carcinoma susceptibility QTL1	2.9	0.04	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	11	12823152	57823152	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

RH140735

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	33,655,489 - 33,655,707 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	34,564,683 - 34,564,900	NCBI	Rnor6.0
Rnor_5.0	11	38,152,432 - 38,152,649	UniSTS	Rnor5.0
RGSC_v3.4	11	34,582,087 - 34,582,304	UniSTS	RGSC3.4
Celera	11	34,794,084 - 34,794,301	UniSTS
Cytogenetic Map	11	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	66	154	90	89	58	44	58	6	294	137	6	130	76	92	31	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002289 ⟹ ENSRNOP00000002289

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	47,118,147 - 47,126,244 (+)	Ensembl
mRatBN7.2 Ensembl	11	33,648,486 - 33,656,584 (+)	Ensembl
Rnor_6.0 Ensembl	11	34,557,679 - 34,565,776 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000125388 ⟹ ENSRNOP00000107829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	47,118,147 - 47,131,954 (+)	Ensembl

RefSeq Acc Id:

NM_001105892 ⟹ NP_001099362

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	47,118,147 - 47,126,244 (+)	NCBI
mRatBN7.2	11	33,648,486 - 33,656,584 (+)	NCBI
Rnor_6.0	11	34,557,679 - 34,565,776 (+)	NCBI
Rnor_5.0	11	38,145,428 - 38,153,525 (+)	NCBI
RGSC_v3.4	11	34,575,083 - 34,583,180 (+)	RGD
Celera	11	34,793,208 - 34,801,305 (-)	RGD

Sequence:

show sequence

GCGAGCCGGTAGGTGAGCGCGCTGGGCCAGGGGGGACCAGGCGCCGTCGGGCTGCGGGACTCGC
GCGACGCCCGCACCATGAGACCCGAGGCGGCCGCAGCCCGGGAGGCGCAGGGACGCATCTCCCA
CTGTCCGGGGGATGATCCCGGGAGGCCACCGCTGCCACGCGGGCCAGAAAGTTCCATTCCAGCC
CCGTGGAGACCGTGGATGTCGCCTCCCAGAGATGCTGATCTGACCAGAACTGAACGTCCGCCTT
GGGAGGACCAACAAACCTTGGGGTCAAAGGGAGCCTTTGGATTCCAGCATCCTGTCAGACTTTA
CTTGCCCATTTCAAAGCGTCAAGAATACCTGCAGAGTTCTGGGGAAAAAGTGCTGGCCAGCTTC
CCAGTGCAAGCCACCATTCATTTCTACAACGATGACTCTGAGTCTAGCTCTGAGGAGGAGCAGG
AGGAGGAGGCTCAGCCCAACCACCTTCAGTGCCTGGAGGCAGAAGTCAGGGATTCCGCTCTGGA
GGAAAGGGCAGAGTAAGTGGCAAACCTGTGAGACAAAGGAGTGGCCTCTGGAAGGGTAGCTGCC
TGCAAACTGAGAGAGCCTCTCTCCTATGCTGGTCACTGTGTCCCAGGGACAGCCTAGCCTGCCA
GGATTCTTCTCCAGCCTCCTCTGTGGCAAGTTCAGAGGCTGGACTGTGCTCAGTACCTGCTCAG
GCCACGAACTCAACTTCTATTTTCTTGATGTATGTATGTGTGTGTGTGTGTGTCTGTGTCTGTG
TATCTGTCTGTGTGTGTGCACACATGTGCTCATGCATACTTTTGAGGAAGGGTGCCTGATGAGG
TGCTCTCAGGAAGAAGGCCTTTGGAGCTCACTGCCACTCTGAATGTTACTCATCCGTAAGTCTC
ACCACCCCTCTCTTGCCCAGAGACCCATTATCTAGTGATTCTTCCCTTCATAAAAATAATTTAA
ATATTAATTCAAATGTTAAGAGTTCATTTGGTTATTCATTTTAAGAGTTTCATTTGAATGAAAG
TAGCTGTTTGGAAAAATATCCTTTTACTTGCCAAAAAAAAAAAAAAAAAAAACCAAAATTAAAA
CACTGAATAATTTTCACAGGAATAAGAAGTAAGAAGTTAAGATCTCTTTAGGGGATAAAACAGC
TGTTTCTGAGAACTGTATAAGAGCTGTGTGTTTAAGTATATATGTTATAAGGGGTTAATTTTTA
TTACTTGGTGACCAGCATGGTCTTGTTATTTGCATGAAATGGCACTATTTTTAATTAAAGTTTC
TTATGTGAAAATTGCTTTGAGTTTTATCATTTTGACAATCCAAGGACTCTGCCATCAAGGCTCT
CCCTAATTATCTTACCAGAATCTGTCTTCCTGTATATTCCACCCTGTATGGATTTTTACTTGGA
ATAAATATTTTGAAAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099362	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76722	(Get FASTA)	NCBI Sequence Viewer
	EDL76723	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002289
	ENSRNOP00000002289.4
	ENSRNOP00000107829.1

RefSeq Acc Id:	NP_001099362 ⟸ NM_001105892
- UniProtKB:	D4AA46 (UniProtKB/TrEMBL), A6KPY0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRPEAAAAREAQGRISHCPGDDPGRPPLPRGPESSIPAPWRPWMSPPRDADLTRTERPPWEDQQ TLGSKGAFGFQHPVRLYLPISKRQEYLQSSGEKVLASFPVQATIHFYNDDSESSSEEEQEEEAQ PNHLQCLEAEVRDSALEERAE hide sequence

Ensembl Acc Id:

ENSRNOP00000002289 ⟸ ENSRNOT00000002289

Ensembl Acc Id:

ENSRNOP00000107829 ⟸ ENSRNOT00000125388

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AA46-F1-model_v2	AlphaFold	D4AA46	1-149	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308788	AgrOrtholog
BioCyc Gene	G2FUF-21770	BioCyc
Ensembl Genes	ENSRNOG00000001684	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002289	ENTREZGENE
	ENSRNOT00000002289.7	UniProtKB/TrEMBL
	ENSRNOT00000125388.1	UniProtKB/TrEMBL
InterPro	Ripply_fam	UniProtKB/TrEMBL
KEGG Report	rno:288239	UniProtKB/TrEMBL
NCBI Gene	288239	ENTREZGENE
PANTHER	PROTEIN RIPPLY3	UniProtKB/TrEMBL
	PTHR16770	UniProtKB/TrEMBL
Pfam	Ripply	UniProtKB/TrEMBL
PhenoGen	Ripply3	PhenoGen
RatGTEx	ENSRNOG00000001684	RatGTEx
UniProt	A0ABK0LRG3_RAT	UniProtKB/TrEMBL
	A6KPY0	ENTREZGENE, UniProtKB/TrEMBL
	D4AA46	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-07	Ripply3	ripply transcriptional repressor 3	Ripply3	ripply3 homolog (zebrafish)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-06-14	Ripply3	ripply3 homolog (zebrafish)	Dscr6	Down syndrome critical region gene 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-01-14	Dscr6	Down syndrome critical region gene 6	Dscr6	Down syndrome critical region homolog 6 (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Dscr6	Down syndrome critical region homolog 6 (human)	Dscr6_predicted	Down syndrome critical region homolog 6 (human) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Dscr6_predicted	Down syndrome critical region homolog 6 (human) (predicted)		Down syndrome critical region gene 6 (predicted)	Name updated	1299863	APPROVED
2005-01-12	Dscr6_predicted	Down syndrome critical region gene 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message