Advanced Search (OLGA)

Gene: Ssh3 (slingshot protein phosphatase 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ssh3

Name:

slingshot protein phosphatase 3

RGD ID:

1308679

Description:

Predicted to enable actin binding activity and phosphoprotein phosphatase activity. Predicted to be involved in actin cytoskeleton organization and negative regulation of actin filament polymerization. Predicted to be located in cytoskeleton and nucleus. Predicted to be active in cytoplasm. Orthologous to human SSH3 (slingshot protein phosphatase 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC365396; protein phosphatase Slingshot homolog 3; slingshot homolog 3; slingshot homolog 3 (Drosophila); SSH-3L; SSH-like protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SSH3 (slingshot protein phosphatase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ssh3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ssh3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SSH3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SSH3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ssh3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SSH3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SSH3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ssh3 (slingshot protein phosphatase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SSH3 (slingshot protein phosphatase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ssh3 (slingshot protein phosphatase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-203d1.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ssh	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ssh3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI		GRCr8
mRatBN7.2	1	201,557,167 - 201,565,577 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,557,169 - 201,564,753 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,909,254 - 209,916,741 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,002,615 - 217,010,105 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	209,693,633 - 209,701,123 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	219,511,908 - 219,519,398 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,511,910 - 219,519,398 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	226,382,004 - 226,389,511 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,848,015 - 206,856,178 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,001,469 - 207,009,631 (-)	NCBI
Celera	1	199,101,483 - 199,108,974 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ssh3	Rat	Aicardi-Goutieres Syndrome 3		ISO	SSH3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 3	ClinVar	PMID:28492532
Ssh3	Rat	immunodeficiency 90		ISO	SSH3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Infections more ...	ClinVar	PMID:28492532
Ssh3	Rat	intellectual disability		ISO	SSH3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ssh3	Rat	17beta-estradiol	affects expression	ISO	SSH3 (Homo sapiens)	6480464	Estradiol affects the expression of SSH3 mRNA	CTD	PMID:22574217
Ssh3	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Ssh3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ssh3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SSH3 mRNA	CTD	PMID:21570461
Ssh3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SSH3 mRNA	CTD	PMID:32109520
Ssh3	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of SSH3 mRNA	CTD	PMID:21346803
Ssh3	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of SSH3 protein	CTD	PMID:31675489
Ssh3	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSH3 mRNA	CTD	PMID:28628672
Ssh3	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	SSH3 (Homo sapiens)	6480464	Decitabine affects the expression of SSH3 mRNA	CTD	PMID:23300844
Ssh3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of SSH3 mRNA	CTD	PMID:30047161
Ssh3	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of SSH3 mRNA	CTD	PMID:28959563
Ssh3	Rat	acrylamide	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Acrylamide results in decreased expression of SSH3 mRNA	CTD	PMID:32763439
Ssh3	Rat	all-trans-retinoic acid	increases expression	ISO	SSH3 (Homo sapiens)	6480464	Tretinoin results in increased expression of SSH3 mRNA	CTD	PMID:23724009
Ssh3	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of SSH3 mRNA	CTD	PMID:30047161
Ssh3	Rat	arsane	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	arsenic atom	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	benzo[a]pyrene	increases methylation	ISO	SSH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SSH3 promoter	CTD	PMID:27901495
Ssh3	Rat	benzo[a]pyrene	decreases methylation	ISO	SSH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of SSH3 3' UTR	CTD	PMID:27901495
Ssh3	Rat	beta-lapachone	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of SSH3 mRNA	CTD	PMID:38218311
Ssh3	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SSH3 mRNA	CTD	PMID:25181051
Ssh3	Rat	bisphenol A	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	bisphenol A results in decreased expression of SSH3 protein	CTD	PMID:31675489
Ssh3	Rat	bisphenol A	increases expression	ISO	Ssh3 (Mus musculus)	6480464	bisphenol A results in increased expression of SSH3 mRNA	CTD	PMID:29165653
Ssh3	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SSH3 gene	CTD	PMID:28505145
Ssh3	Rat	bisphenol F	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSH3 mRNA	CTD	PMID:28628672
Ssh3	Rat	butanal	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of SSH3 mRNA	CTD	PMID:26079696
Ssh3	Rat	chrysene	increases expression	ISO	Ssh3 (Mus musculus)	6480464	chrysene results in increased expression of SSH3 mRNA	CTD	PMID:26377693
Ssh3	Rat	cisplatin	affects expression	ISO	SSH3 (Homo sapiens)	6480464	Cisplatin affects the expression of SSH3 mRNA	CTD	PMID:23300844
Ssh3	Rat	cisplatin	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of SSH3 mRNA	CTD	PMID:27392435
Ssh3	Rat	decabromodiphenyl ether	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of SSH3 protein	CTD	PMID:31675489
Ssh3	Rat	dexamethasone	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSH3 mRNA	CTD	PMID:28628672
Ssh3	Rat	doxorubicin	increases expression	ISO	SSH3 (Homo sapiens)	6480464	Doxorubicin results in increased expression of SSH3 mRNA	CTD	PMID:16404146
Ssh3	Rat	indometacin	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSH3 mRNA	CTD	PMID:28628672
Ssh3	Rat	lead diacetate	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	lead acetate results in decreased expression of SSH3 mRNA	CTD	PMID:38568856
Ssh3	Rat	manganese atom	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	manganese(0)	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	manganese(II) chloride	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of SSH3 mRNA	CTD	PMID:30047161
Ssh3	Rat	ozone	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of SSH3 mRNA	CTD	PMID:35430440
Ssh3	Rat	paracetamol	affects expression	ISO	Ssh3 (Mus musculus)	6480464	Acetaminophen affects the expression of SSH3 mRNA	CTD	PMID:17562736
Ssh3	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of SSH3 mRNA	CTD	PMID:33387578
Ssh3	Rat	paracetamol	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of SSH3 mRNA	CTD	PMID:29067470
Ssh3	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of SSH3 mRNA	CTD	PMID:30047161
Ssh3	Rat	silicon dioxide	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of SSH3 mRNA	CTD	PMID:25895662
Ssh3	Rat	sodium arsenite	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of SSH3 mRNA	CTD	PMID:38568856
Ssh3	Rat	sodium arsenite	multiple interactions	ISO	SSH3 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SSH3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SSH3 mRNA	CTD	PMID:39836092
Ssh3	Rat	sunitinib	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Sunitinib results in decreased expression of SSH3 mRNA	CTD	PMID:31533062
Ssh3	Rat	temozolomide	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Temozolomide results in decreased expression of SSH3 mRNA	CTD	PMID:31758290
Ssh3	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of SSH3 mRNA	CTD	PMID:23411599
Ssh3	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of SSH3 mRNA	CTD	PMID:34492290
Ssh3	Rat	thiram	decreases expression	ISO	SSH3 (Homo sapiens)	6480464	Thiram results in decreased expression of SSH3 mRNA	CTD	PMID:38568856
Ssh3	Rat	titanium dioxide	decreases methylation	ISO	Ssh3 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SSH3 gene	CTD	PMID:35295148
Ssh3	Rat	triclosan	increases expression	ISO	SSH3 (Homo sapiens)	6480464	Triclosan results in increased expression of SSH3 mRNA	CTD	PMID:30510588
Ssh3	Rat	triphenyl phosphate	affects expression	ISO	SSH3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SSH3 mRNA	CTD	PMID:37042841
Ssh3	Rat	valproic acid	increases expression	ISO	Ssh3 (Mus musculus)	6480464	Valproic Acid results in increased expression of SSH3 mRNA	CTD	PMID:21427059
Ssh3	Rat	valproic acid	increases methylation	ISO	SSH3 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of SSH3 gene	CTD	PMID:29154799
Ssh3	Rat	valproic acid	affects expression	ISO	SSH3 (Homo sapiens)	6480464	Valproic Acid affects the expression of SSH3 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ssh3	Rat	actin cytoskeleton organization	involved_in	IBA	PANTHER:PTN002228479 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ssh3	Rat	negative regulation of actin filament polymerization	involved_in	IEA	InterPro:IPR043587	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ssh3	Rat	negative regulation of actin filament polymerization	involved_in	IBA	FB:FBgn0029157 and PANTHER:PTN002228479	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ssh3	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN002228479 and UniProtKB:Q8WYL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ssh3	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ssh3	Rat	cytoskeleton	located_in	IEA	UniProtKB-SubCell:SL-0090	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ssh3	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ssh3	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ssh3	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ssh3	Rat	actin binding	enables	IEA	InterPro:IPR043587	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ssh3	Rat	actin binding	enables	IBA	FB:FBgn0029157 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ssh3	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ssh3	Rat	phosphatase activity	enables	IEA	InterPro:IPR043587	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ssh3	Rat	phosphoprotein phosphatase activity	enables	IEA	UniProtKB-KW:KW-0904	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ssh3	Rat	phosphoprotein phosphatase activity	enables	IBA	FB:FBgn0029157 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ssh3	Rat	protein binding	enables	ISO	SSH3 (Homo sapiens)	1624291	UniProtKB:O43639 and PMID:32296183	RGD	PMID:32296183
Ssh3	Rat	protein serine/threonine phosphatase activity	enables	IEA	EC:3.1.3.16	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ssh3	Rat	protein serine/threonine phosphatase activity	enables	IEA	RHEA:20629 and RHEA:47004	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ssh3	Rat	protein tyrosine phosphatase activity	enables	IEA	RHEA:10684	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ssh3	Rat	protein tyrosine phosphatase activity	enables	IEA	EC:3.1.3.48	1600115	GO_REF:0000003	UniProt	GO_REF:0000003

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334

Ssh3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI		GRCr8
mRatBN7.2	1	201,557,167 - 201,565,577 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,557,169 - 201,564,753 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,909,254 - 209,916,741 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,002,615 - 217,010,105 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	209,693,633 - 209,701,123 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	219,511,908 - 219,519,398 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,511,910 - 219,519,398 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	226,382,004 - 226,389,511 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,848,015 - 206,856,178 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,001,469 - 207,009,631 (-)	NCBI
Celera	1	199,101,483 - 199,108,974 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

SSH3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	67,303,530 - 67,312,592 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	67,303,478 - 67,312,607 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	67,071,001 - 67,080,063 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	66,827,577 - 66,836,647 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	66,827,672 - 66,836,638	NCBI
Celera	11	64,403,558 - 64,412,717 (+)	NCBI		Celera
Cytogenetic Map	11	q13.2	NCBI
HuRef	11	63,399,553 - 63,408,712 (+)	NCBI		HuRef
CHM1_1	11	66,953,914 - 66,963,073 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	67,297,494 - 67,306,556 (+)	NCBI		T2T-CHM13v2.0

Ssh3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	4,311,696 - 4,319,261 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	4,311,696 - 4,319,208 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	4,261,668 - 4,269,233 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	4,261,668 - 4,269,180 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	4,261,668 - 4,269,172 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	4,261,668 - 4,269,172 (-)	NCBI		MGSCv36	mm8
Celera	19	4,133,020 - 4,140,524 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	3.96	NCBI

Ssh3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	18,147,149 - 18,158,254 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	18,149,846 - 18,158,257 (-)	NCBI	ChiLan1.0	ChiLan1.0

SSH3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	68,530,212 - 68,539,375 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	69,572,806 - 69,581,920 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	62,661,752 - 62,670,869 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	65,975,362 - 65,984,458 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	65,975,486 - 65,983,716 (+)	Ensembl	panpan1.1		panPan2

SSH3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	50,126,646 - 50,134,799 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	50,126,663 - 50,134,729 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	48,736,773 - 48,744,910 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	51,075,693 - 51,083,848 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	51,075,706 - 51,083,710 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	50,261,615 - 50,269,761 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	49,836,089 - 49,844,226 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	50,630,695 - 50,638,841 (-)	NCBI		UU_Cfam_GSD_1.0

Ssh3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	5,971,774 - 5,979,866 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	2,414,090 - 2,422,361 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	2,414,128 - 2,422,183 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SSH3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	5,185,503 - 5,193,155 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	5,185,480 - 5,193,875 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	3,968,553 - 3,976,624 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SSH3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	6,951,130 - 6,960,445 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	6,951,139 - 6,959,441 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	104,237,806 - 104,247,095 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ssh3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	19,185,251 - 19,194,680 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	19,186,390 - 19,194,624 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ssh3
18 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	529
Count of miRNA genes:	244
Interacting mature miRNAs:	290
Transcripts:	ENSRNOT00000025546
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	199773958	202166723	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

AA926337

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	201,565,744 - 201,565,896 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	219,520,485 - 219,520,636	NCBI	Rnor6.0
Rnor_5.0	1	226,390,598 - 226,390,749	UniSTS	Rnor5.0
RGSC_v3.4	1	206,857,265 - 206,857,416	UniSTS	RGSC3.4
Celera	1	199,110,061 - 199,110,212	UniSTS
RH 3.4 Map	1	1559.6	UniSTS
Cytogenetic Map	1	q42	UniSTS

BF399542

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	201,565,035 - 201,565,220 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	219,519,776 - 219,519,960	NCBI	Rnor6.0
Rnor_5.0	1	226,389,889 - 226,390,073	UniSTS	Rnor5.0
RGSC_v3.4	1	206,856,556 - 206,856,740	UniSTS	RGSC3.4
Celera	1	199,109,352 - 199,109,536	UniSTS
RH 3.4 Map	1	1559.2	UniSTS
Cytogenetic Map	1	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001012217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025546 ⟹ ENSRNOP00000025546

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,557,169 - 201,564,753 (-)	Ensembl
Rnor_6.0 Ensembl	1	219,511,910 - 219,519,398 (-)	Ensembl

RefSeq Acc Id:

NM_001012217 ⟹ NP_001012217

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,094 (-)	NCBI
mRatBN7.2	1	201,557,168 - 201,564,658 (-)	NCBI
Rnor_6.0	1	219,511,908 - 219,519,398 (-)	NCBI
Rnor_5.0	1	226,382,004 - 226,389,511 (-)	NCBI
RGSC_v3.4	1	206,848,015 - 206,856,178 (-)	RGD
Celera	1	199,101,483 - 199,108,974 (-)	RGD

Sequence:

show sequence

GCGAAGGCAGGGACTGACCGTATAGTTGTGGGAGGGGTCGTGCCGGGTGCTCGCCCAGGTGTTCCTGGCCTGCCTGCCTTATGGCGCTGGTCACAGTGAGTCGCTCGCCACCGGCAAGTGGCCACTCC
ACGCCTGTGGGACCCACGGACCGAGTGATAAGACGCAGAGGCCGGCTCCAACGCAGGCAGAGTTTTGCTGTTCTCCGAGGGGCTGTCCTGGGACTTCAGGATGGAGGGGAAGGGAATGATGCAGCTGA
GGCTGACCCTGAGCCAATGGAGAAGCCCTCAGGTGAGGAGCAGCCCGCTGAGGACCAGACTGACAACGGGCAAGGGTCCCAGAGTCCCTGGAAACAAGTGCAGAAGCGGCACCTGCACCTTATGGTGG
AGCTGCTGAGGCCACAGGATGATATCCGCCTGGCAGCCCAGCTGGAGGCAGCCCGACCCCCAAGGCTTCGCTATCTGCTGGTAGTGTCCACAGGAGAGGGTCTGAGTGAGGAGGAGACCATCCTTCTT
GGGGTGGACTTCCCTGACAGCAGTTCCCACAGCTGCACCCTGGGCCTGGTCTTGCCCCTCTGGAGTGATACCCAGGTGTACCTGGATGGTGATGGGGGCTTCAGTGTGACATCTGGTGGTCAGAGCCG
AATCTTCAAGCCTGTCTCTATCCAGACCATGTGGGCCACACTGCAGGTATTGCACCAGGCATGTGAGGTGGCTCTAGGCAGTGGCCTTGTGCCTGGTGGCAGTGCCCTTGCCTGGGCCACTCACTACC
AGGAGAAACTGAACTCTGACCAGGGTTGCCTCAATGAGTGGATGGCCATGTCTGACCTGGAGTCCTTTCGACCACCTAATGCTGAGCCTGGACAGGCTTCAGAACAAGAGCAGATGGAACAGGCAATC
TTGGCTGAATTGTGGCAGGTGTTGGATGCCAGTGACCTGGACAGTGTTACGTCTAAAGAGATCCGTCAGGCCCTGGAGCTGCGTCTAGGATGCCCTCTCCAGCAGTACCGTGACTTTATTGACAACCA
GATGCTGCTGCTCATGGCCCAGCAAGACCGGGCCTCCCGCATCTTCCCCCACCTCTACTTGGGTTCTGAATGGAATGCTGCCAACCTGGAGGAACTTCAGAGAAACAGGGTAAGTCACATCCTGAACA
TGGCCCGGGAGATTGACAACTTCTTCCCCGAACGATTCACCTATCACAATGTACGTGTCTGGGACGAAGAGTCAGCACAGCTGCTACCCCACTGGAAGGAGACACATCGATTCATTGAGGATGCCAGA
GCACAGGGCACTCGGGTGCTAGTCCACTGTAAGATGGGCGTCAGCCGTTCTGCTGCCACGGTACTGGCCTATGCCATGAAACAGTATGGCTGGGGCCTCGAGCAAGCCCTGATCCACGTGCAGGAGCT
CCGGCCCATTGTACGCCCCAACCCTGGCTTCCTGCGCCAGCTACAGACCTACCAGGGCATTCTGACTGCCAGCCGGCAGAGCCACGTCTGGGAGCAGAAAGTGGGTGTGGTCTCCCCAGAGGAGCCCT
TGGCACCTGAAGTTTCTACACCATTGCCACCTCTTCCACCAGAACCAGGGGGCAGTGGAGAGGGGATGGTTATGGGCCAGAAAGGAAGCCAGGAAACCCCAAAAGAAGAGCTTGGACTGCGGCCCCGC
ATCAACCTCCGGGGGGTCATGCGCTCCATCAGTCTTCTGGAGCCCTCCTCAGAGCCAGAGAGTACCACAGAGGCTGGAGACCTGCCAGAAGTTTTCTCTTCTGATGAAGAACCTCTTCATCCCTTCTC
TCAGCTTTCAAGAGCCAAAGGTGGCCAGCGGGTCTGCAAGGGACCTTGGCCTGCCCTGAAGTCTCGACAGTCTGTGGTTGCCCTTCATAGTGCTGCCCTGGTGGCTAGCAGGGCACGAGCCTTCCAGG
GGCAAGGGCAAGGGCAGGGCCAAGAGCAGAGGGAGACTGGTACATCTTCTACACCTAGGCTCCGGAAGGTGATAAGGCAGGCCAGTGTAGATGACAGCAGGGAGGAGGGCAAGGCCTGAGGCCTTATG
CCATATCCCCACCTAGACACTAAGCAATGATTGGTCACTTTGCATTGGGCCTGCACACTCCCTATAGCTCCTTCCCAGCAGTCCTCAGACCCTTGTCACTTCCTGCAACCTTAGGTCTCAGACCCATG
TCTACCTGTTAAGGGCTCAAGACTTTTTCTACATAGGGTATGGGTTAGAACCATTCAAGGTGCCTTTAAGGGTAACAACACCCTAGTTTCATTTTACACTCACTCTCTTAACACTTTGTGCAGCCCTG
GAATTAAAACCGGAAATTTTTAGGGTGGGTTTTCTAGTTCACATCTCCCTTGCTCTCAACTGCTGGCCATTCCACCCTGTGTCTTTTACCCTCTCCTACCGCAGTCCTACAGGCAGCTAGGCCAGGGA
ACCAGTGGCCACAAAGGCAGATAGCACTTTCAGCCCCCAGTCCCACAGGCTCTGAGGGGGCTCCCAGGTTACCACCCACCCACACAACTGACCAGAGTCTCTGCCGTTGCCCTCATTTCTCCCATGCC
CCACACTGGGTCACAGGGCACTGAGCTAAAAAGAGAGTCTTCTTGTTCTTGAAGATCTCTGGCTAGTCAAGTTTTTCATAGTCGTATAGTATCTGGCTTTGTACTGAGAAATAAAAGACATTTTCATA
TTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085500 ⟹ XP_038941428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI
mRatBN7.2	1	201,557,168 - 201,565,577 (-)	NCBI

RefSeq Acc Id:

XM_039085503 ⟹ XP_038941431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI
mRatBN7.2	1	201,557,168 - 201,565,577 (-)	NCBI

RefSeq Acc Id:

XM_039085516 ⟹ XP_038941444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI
mRatBN7.2	1	201,557,167 - 201,565,445 (-)	NCBI

RefSeq Acc Id:

XM_039085526 ⟹ XP_038941454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI
mRatBN7.2	1	201,557,167 - 201,565,445 (-)	NCBI

RefSeq Acc Id:

XM_039085559 ⟹ XP_038941487

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,988,848 - 210,994,975 (-)	NCBI
mRatBN7.2	1	201,559,413 - 201,565,577 (-)	NCBI

RefSeq Acc Id:

XM_063269833 ⟹ XP_063125903

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI

RefSeq Acc Id:

XM_063269836 ⟹ XP_063125906

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269840 ⟹ XP_063125910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269844 ⟹ XP_063125914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI

RefSeq Acc Id:

XM_063269847 ⟹ XP_063125917

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,975 (-)	NCBI

RefSeq Acc Id:

XM_063269848 ⟹ XP_063125918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269855 ⟹ XP_063125925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269858 ⟹ XP_063125928

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269859 ⟹ XP_063125929

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269861 ⟹ XP_063125931

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,914 (-)	NCBI

RefSeq Acc Id:

XM_063269862 ⟹ XP_063125932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,994,881 (-)	NCBI

RefSeq Acc Id:

XM_063269864 ⟹ XP_063125934

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,991,407 (-)	NCBI

RefSeq Acc Id:

XM_063269869 ⟹ XP_063125939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,991,384 (-)	NCBI

RefSeq Acc Id:

XM_063269871 ⟹ XP_063125941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,986,604 - 210,991,398 (-)	NCBI


Protein RefSeqs	NP_001012217	(Get FASTA)	NCBI Sequence Viewer
	XP_038941428	(Get FASTA)	NCBI Sequence Viewer
	XP_038941431	(Get FASTA)	NCBI Sequence Viewer
	XP_038941444	(Get FASTA)	NCBI Sequence Viewer
	XP_038941454	(Get FASTA)	NCBI Sequence Viewer
	XP_038941487	(Get FASTA)	NCBI Sequence Viewer
	XP_063125903	(Get FASTA)	NCBI Sequence Viewer
	XP_063125906	(Get FASTA)	NCBI Sequence Viewer
	XP_063125910	(Get FASTA)	NCBI Sequence Viewer
	XP_063125914	(Get FASTA)	NCBI Sequence Viewer
	XP_063125917	(Get FASTA)	NCBI Sequence Viewer
	XP_063125918	(Get FASTA)	NCBI Sequence Viewer
	XP_063125925	(Get FASTA)	NCBI Sequence Viewer
	XP_063125928	(Get FASTA)	NCBI Sequence Viewer
	XP_063125929	(Get FASTA)	NCBI Sequence Viewer
	XP_063125931	(Get FASTA)	NCBI Sequence Viewer
	XP_063125932	(Get FASTA)	NCBI Sequence Viewer
	XP_063125934	(Get FASTA)	NCBI Sequence Viewer
	XP_063125939	(Get FASTA)	NCBI Sequence Viewer
	XP_063125941	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83600	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025546
	ENSRNOP00000106566
GenBank Protein	Q5XIS1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012217 ⟸ NM_001012217

- UniProtKB:

Q5XIS1 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MALVTVSRSPPASGHSTPVGPTDRVIRRRGRLQRRQSFAVLRGAVLGLQDGGEGNDAAEADPEPMEKPSGEEQPAEDQTDNGQGSQSPWKQVQKRHLHLMVELLRPQDDIRLAAQLEAARPPRLRYLL
VVSTGEGLSEEETILLGVDFPDSSSHSCTLGLVLPLWSDTQVYLDGDGGFSVTSGGQSRIFKPVSIQTMWATLQVLHQACEVALGSGLVPGGSALAWATHYQEKLNSDQGCLNEWMAMSDLESFRPPN
AEPGQASEQEQMEQAILAELWQVLDASDLDSVTSKEIRQALELRLGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNMAREIDNFFPERFTYHNVRVWDEESAQ
LLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATVLAYAMKQYGWGLEQALIHVQELRPIVRPNPGFLRQLQTYQGILTASRQSHVWEQKVGVVSPEEPLAPEVSTPLPPLPPEPGGSGEGMVMGQ
KGSQETPKEELGLRPRINLRGVMRSISLLEPSSEPESTTEAGDLPEVFSSDEEPLHPFSQLSRAKGGQRVCKGPWPALKSRQSVVALHSAALVASRARAFQGQGQGQGQEQRETGTSSTPRLRKVIRQ
ASVDDSREEGKA

hide sequence

Ensembl Acc Id:

ENSRNOP00000025546 ⟸ ENSRNOT00000025546

RefSeq Acc Id:	XP_038941454 ⟸ XM_039085526
- Peptide Label:	isoform X8
- UniProtKB:	A6HYW8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941444 ⟸ XM_039085516
- Peptide Label:	isoform X6
- UniProtKB:	F1LR78 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941431 ⟸ XM_039085503
- Peptide Label:	isoform X2

Protein Domains

DEK-C Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIS1-F1-model_v2	AlphaFold	Q5XIS1	1-652	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13690622

Promoter ID:

EPDNEW_R1146

Type:

initiation region

Name:

Ssh3_1

Description:

slingshot protein phosphatase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	219,519,410 - 219,519,470	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56759	BioCyc
Ensembl Genes	ENSRNOG00000018878	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025546	ENTREZGENE
	ENSRNOT00000173405	ENTREZGENE
Gene3D-CATH	3.90.190.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7133065	IMAGE-MGC_LOAD
InterPro	DEK_C	UniProtKB/Swiss-Prot
	Dual-sp_phosphatase_cat-dom	UniProtKB/Swiss-Prot
	Phosphatase_SSH-like	UniProtKB/Swiss-Prot
	Prot-tyrosine_phosphatase-like	UniProtKB/Swiss-Prot
	Tyr_Pase_AS	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_dom	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:365396	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94343	IMAGE-MGC_LOAD
NCBI Gene	365396	ENTREZGENE
PANTHER	PROTEIN PHOSPHATASE SLINGSHOT HOMOLOG 3	UniProtKB/Swiss-Prot
	PTHR45864	UniProtKB/Swiss-Prot
Pfam	DEK_C	UniProtKB/Swiss-Prot
	DSPc	UniProtKB/Swiss-Prot
PhenoGen	Ssh3	PhenoGen
PROSITE	DEK_C	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_1	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_2	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018878	RatGTEx
SMART	DSPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	DEK C-terminal domain	UniProtKB/Swiss-Prot
	SSF52799	UniProtKB/Swiss-Prot
UniProt	A6HYW8	ENTREZGENE, UniProtKB/TrEMBL
	F1LR78	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIS1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-20	Ssh3	slingshot protein phosphatase 3	Ssh3	slingshot homolog 3 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ssh3	slingshot homolog 3 (Drosophila)	Ssh3_predicted	slingshot homolog 3 (Drosophila) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ssh3_predicted	slingshot homolog 3 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar