Atad1 (ATPase family, AAA domain containing 1)

Advanced Search (OLGA)

Gene: Atad1 (ATPase family, AAA domain containing 1) Rattus norvegicus

Analyze

Symbol:

Atad1

Name:

ATPase family, AAA domain containing 1

RGD ID:

1308570

Description:

Predicted to enable ATP hydrolysis activity. Predicted to be involved in several processes, including extraction of mislocalized protein from mitochondrial outer membrane; learning or memory; and regulation of receptor internalization. Predicted to be located in mitochondrion; peroxisomal membrane; and postsynaptic membrane. Predicted to be active in glutamatergic synapse; mitochondrial outer membrane; and postsynapse. Human ortholog(s) of this gene implicated in hyperekplexia 4. Orthologous to human ATAD1 (ATPase family AAA domain containing 1); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ab2-088; ATPase family AAA domain-containing protein 1; LOC309532; neuroprotective protein 6; outer mitochondrial transmembrane helix translocase; thorase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATAD1 (ATPase family AAA domain containing 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Atad1 (ATPase family, AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atad1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATAD1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATAD1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atad1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATAD1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATAD1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atad1 (ATPase family AAA domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATAD1 (ATPase family AAA domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atad1 (ATPase family, AAA domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atad1b (ATPase family AAA domain containing 1b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4701	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MSP1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mspn-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nmd	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atad1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	239,957,329 - 240,023,792 (-)	NCBI		GRCr8
mRatBN7.2	1	230,544,227 - 230,610,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	230,544,047 - 230,596,548 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	238,919,429 - 238,964,037 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	245,849,131 - 245,893,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	238,687,243 - 238,731,853 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	251,234,702 - 251,386,996 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	251,235,508 - 251,387,002 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	258,466,598 - 258,500,477 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	236,682,640 - 236,726,705 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	236,847,840 - 236,898,593 (-)	NCBI
Celera	1	227,659,669 - 227,703,783 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hyperekplexia 4 (ISO)

juvenile polyposis syndrome (ISO)

PTEN hamartoma tumor syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2-amino-4,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4-amino-2,6-dinitrotoluene (EXP)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (EXP)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cocaine (EXP)

coumarin (ISO)

cyclosporin A (ISO)

D-glucose (EXP)

dicrotophos (ISO)

dioxygen (EXP)

fenthion (ISO)

FR900359 (ISO)

glucose (EXP)

ivermectin (ISO)

leflunomide (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

testosterone (ISO)

thioacetamide (EXP)

tolcapone (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

extraction of mislocalized protein from mitochondrial outer membrane (IBA,ISO,ISS)

learning (ISO,ISS)

memory (ISO,ISS)

negative regulation of synaptic transmission, glutamatergic (ISO,ISS)

positive regulation of receptor internalization (ISO,ISS)

regulation of postsynaptic neurotransmitter receptor internalization (ISO)

Cellular Component

glutamatergic synapse (ISO)

mitochondrial outer membrane (IBA,IEA,ISO,ISS)

mitochondrion (ISO)

peroxisomal membrane (IEA,ISO,ISS)

postsynapse (ISO)

postsynaptic membrane (IEA,ISO,ISS)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA,ISO,ISS)

membrane protein dislocase activity (IEA)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior.	Zhang J, etal., Cell. 2011 Apr 15;145(2):284-99. doi: 10.1016/j.cell.2011.03.016.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:18614015	PMID:19946888	PMID:21124846	PMID:21525035	PMID:34800366

Genomics

Comparative Map Data

Atad1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	239,957,329 - 240,023,792 (-)	NCBI		GRCr8
mRatBN7.2	1	230,544,227 - 230,610,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	230,544,047 - 230,596,548 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	238,919,429 - 238,964,037 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	245,849,131 - 245,893,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	238,687,243 - 238,731,853 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	251,234,702 - 251,386,996 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	251,235,508 - 251,387,002 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	258,466,598 - 258,500,477 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	236,682,640 - 236,726,705 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	236,847,840 - 236,898,593 (-)	NCBI
Celera	1	227,659,669 - 227,703,783 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

ATAD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	87,751,512 - 87,841,361 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	87,751,512 - 87,841,361 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	89,511,269 - 89,577,983 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	89,502,855 - 89,567,897 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	89,502,854 - 89,567,897	NCBI
Celera	10	83,259,379 - 83,324,398 (-)	NCBI		Celera
Cytogenetic Map	10	q23.31	NCBI
HuRef	10	83,148,033 - 83,212,913 (-)	NCBI		HuRef
CHM1_1	10	89,795,178 - 89,860,216 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	88,635,419 - 88,725,279 (-)	NCBI		T2T-CHM13v2.0

Atad1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	32,649,958 - 32,717,187 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	32,649,038 - 32,717,186 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	32,672,558 - 32,739,787 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	32,671,638 - 32,739,786 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	32,747,053 - 32,786,788 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	32,738,560 - 32,778,295 (-)	NCBI		MGSCv36	mm8
Celera	19	33,455,381 - 33,495,118 (-)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	27.55	NCBI

Atad1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	5,117,964 - 5,180,578 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	5,118,107 - 5,180,578 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATAD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	99,770,305 - 99,836,126 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	99,775,621 - 99,841,442 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	84,473,087 - 84,544,902 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	87,981,974 - 88,071,098 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	87,981,974 - 88,048,228 (-)	Ensembl	panpan1.1		panPan2

ATAD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	37,749,799 - 37,811,490 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	37,750,649 - 37,794,149 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	37,632,673 - 37,694,311 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	39,280,736 - 39,342,518 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	39,280,736 - 39,325,158 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	37,187,145 - 37,248,760 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	36,769,037 - 36,830,700 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	38,008,503 - 38,070,239 (-)	NCBI		UU_Cfam_GSD_1.0

Atad1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	77,367,884 - 77,438,599 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936735	1,376,526 - 1,422,126 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936735	1,377,168 - 1,423,696 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATAD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	99,815,203 - 99,885,160 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	99,802,939 - 99,885,562 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	108,795,831 - 108,887,914 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATAD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	81,197,332 - 81,285,279 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	41,858,621 - 41,925,226 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atad1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	13,869,934 - 13,919,470 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	13,869,632 - 13,919,468 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atad1
360 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	133
Count of miRNA genes:	112
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000014684
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	234238494	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat

Markers in Region

RH144595

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	230,575,172 - 230,575,326 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	251,266,875 - 251,267,028	NCBI	Rnor6.0
Rnor_5.0	1	258,497,496 - 258,497,649	UniSTS	Rnor5.0
RGSC_v3.4	1	236,713,218 - 236,713,371	UniSTS	RGSC3.4
Celera	1	227,690,239 - 227,690,392	UniSTS
RH 3.4 Map	1	1618.62	UniSTS
Cytogenetic Map	1	q52	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001035002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY325215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC094514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF688601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014684 ⟹ ENSRNOP00000014684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	230,544,047 - 230,589,513 (-)	Ensembl
Rnor_6.0 Ensembl	1	251,235,508 - 251,379,593 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092063 ⟹ ENSRNOP00000072875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	230,545,764 - 230,596,548 (-)	Ensembl
Rnor_6.0 Ensembl	1	251,237,155 - 251,387,002 (-)	Ensembl

RefSeq Acc Id:

NM_001035002 ⟹ NP_001030174

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	239,957,875 - 240,001,957 (-)	NCBI
mRatBN7.2	1	230,544,593 - 230,588,678 (-)	NCBI
Rnor_6.0	1	251,235,977 - 251,379,138 (-)	NCBI
Rnor_5.0	1	258,466,598 - 258,500,477 (-)	NCBI
RGSC_v3.4	1	236,682,640 - 236,726,705 (-)	RGD
Celera	1	227,659,669 - 227,703,783 (-)	RGD

Sequence:

show sequence

CTTCTGTCGTCTCTGGTCTTACCTCTGGGTTAACAATCAAGATGGTACATGCTGAAGCCTTTTC
TCGTCCATTGAGTCGGAACGAAGTTGTCGGTTTAATTTTTCGTTTAACAATCTTTGGTGCAGTA
ACATACTTCACTATTAAATGGATGGTAGATGCCATTGACCCCACCAGGAAGCAGAAAGTGGAAG
CTCAGAAACAGGCGGAAAAACTGATGAAGCAAATTGGTGTGAAAAATGTGAAGCTTTCAGAGTA
TGAGATGAGTATTGCTGCTCATCTGGTAGACCCTCTTAATATGCATGTTACTTGGAGTGATATA
GCAGGTTTAGATGATGTTATTACAGATCTGAAAGACACAGTCATCCTACCTATCAAAAAGAAGC
ATTTGTTTGAGAATTCCAGACTTCTGCAGCCTCCCAAAGGTGTTCTCCTGTATGGACCTCCGGG
CTGTGGGAAAACATTAATTGCCAAAGCGACAGCCAAAGAAGCGGGCTGTCGATTTATTAACCTT
CAGCCTTCCACACTGACAGATAAGTGGTATGGAGAATCTCAGAAACTGGCTGCTGCTGTCTTCT
CCCTGGCCATAAAGCTACAGCCGTCTATCATATTTATCGATGAAATAGACTCATTTCTACGAAA
TCGTTCCAGTTCCGACCACGAAGCTACAGCAATGATGAAAGCCCAGTTTATGAGTCTTTGGGAT
GGACTGGACACTGATCACAGCTGCCAGGTCATAGTGATGGGAGCTACCAATCGTCCTCAAGACC
TTGACTCTGCTATAATGAGAAGAATGCCCACAAGATTTCATATTAACCAGCCTGCTCTAAAACA
AAGAGAAGCAATTTTAAAACTCATCTTGAAAAATGAAAATGTGGATAGACATGTAGATCTTCTA
GAAGTTGCCCAGGAAACTGATGGGTTTTCAGGAAGTGACCTAAAAGAAATGTGTCGAGATGCTG
CCCTCCTCTGCGTCAGGGAATATGTCAATTCTACATCAGAAGAAAGTCATGACGAAGATGAAAT
CCGGCCTGTGCAGCAGCAGGACTTGCATCGGGCAATTGAGAAGATGAAGAAATCAAAGGATGCA
GCGTTTCAGAGCGTTCTGACTCACGTTTGTTTAGATTAGGAGTAAAGATCGTTTGTGTGCTTCA
GTGATCTCGTGGGACGGGCTCTCATCTGTACAGCAGGGAGGGAGATCCAGACTTGTGGTTTTCT
ACTCAGATCTCTGGTCTGTTATATAAATGGTGTTCCTGCTTGTCAGAAATCATGAGGAGGAAGC
TGAGTGCGACCTGAGTGTGGGTGCTTGTTTGACCTTTTTAGCCATATGCTGTTATAGCCTTATA
GAGTCTAAGCTGGTCTTATGTAGTTACTGATTTGTTGTCATTAGTAAGGAATGGGGTGTGGTTA
GGTGCTGGTTTCTAGACATGTGAGTGTGTGTGAGTGTGTGTGAGTGTGTGTGTGTGTGTGTGAG
TGTTTATCAAATGTATATATACACTTTTTTTTATATTCTGTAGATAGGTTTGACTTTTTTTTTT
TAAACCCCAACTACTGAACCCAAAAGTACCAGATAGTTTGTAGCAAAACTGGGATGTAAGGCAG
AGTTGACAGGCACAGCGAGACTCAGCCATTCCTAGTCGTCACTTGTTTGGGCCGTTTTTGAGTT
GAACATTTCCTGTGCAGTTGGTGGAATCAACCACACCTGAACATGTGTGTGTCAGTGGTAATGG
CTGTCGGGAGAGTCAGATAACAAACGCGATTTGCTCTGCGATCGGCGACTCCACCTCACTCTGC
TGTGACACCGAGCAGACATTTTGAAGTTTTACACTGAATTATATTAAGGATTGAAAACCTTTCA
AAAGAATGGGTTTGAGAAACTTCAGTACTCTTTTAGTACGTGTACATAACTCTCAGTGTAACAG
TTCTGTAACTGTATTCCTTAAATGTTGTTTGAAAGTTAAGTGTTCTTTAATTATGTTCAAATTT
AATTTGGTTATCCAAACAAAATGATAGTTTATATAAATAGTTGTTACTAAATGTGCTAAAAAAT
ACTCACTTTGTAACTTAAATTTAAAAATTTTCTCAATAGTATAAAATGGGTACAAATAATTCAT
ATCAAAATTCTTGTATTGTATCTGTAGTCACTCGATGCTATGTGAACCACATACAAAACTCTTC
TTTTTTTCAAACCTCCACTAGCCAGAATTCTGTTCCAGGCATGTGACATGTGACAAAGCAAGAT
GATAATGCCGCAGCACAGTCTTGAGGTGCCTCCGACTCACCAGAACGATTAAACTATGACAAGA
AAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039080657 ⟹ XP_038936585

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	239,957,329 - 240,023,792 (-)	NCBI
mRatBN7.2	1	230,544,227 - 230,610,524 (-)	NCBI

RefSeq Acc Id:

XM_039080662 ⟹ XP_038936590

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	239,957,329 - 240,023,792 (-)	NCBI
mRatBN7.2	1	230,544,227 - 230,610,517 (-)	NCBI

RefSeq Acc Id:

XM_039080671 ⟹ XP_038936599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	239,957,329 - 240,023,779 (-)	NCBI
mRatBN7.2	1	230,544,227 - 230,610,509 (-)	NCBI

RefSeq Acc Id:

XM_039080679 ⟹ XP_038936607

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	239,957,329 - 240,001,952 (-)	NCBI
mRatBN7.2	1	230,544,227 - 230,588,699 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001030174	(Get FASTA)	NCBI Sequence Viewer
	XP_038936585	(Get FASTA)	NCBI Sequence Viewer
	XP_038936590	(Get FASTA)	NCBI Sequence Viewer
	XP_038936599	(Get FASTA)	NCBI Sequence Viewer
	XP_038936607	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH94514	(Get FASTA)	NCBI Sequence Viewer
	AAP92616	(Get FASTA)	NCBI Sequence Viewer
	ABX10437	(Get FASTA)	NCBI Sequence Viewer
	EDM13140	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014684.5
	ENSRNOP00000072875.1
GenBank Protein	Q505J9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001030174 ⟸ NM_001035002

- UniProtKB:

B3STU2 (UniProtKB/Swiss-Prot), Q505J9 (UniProtKB/Swiss-Prot), A6I109 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMKQIGV
KNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSRLLQPPKG
VLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFID
EIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFH
INQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSE
ESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQSVLTHVCLD

hide sequence

Ensembl Acc Id:

ENSRNOP00000072875 ⟸ ENSRNOT00000092063

Ensembl Acc Id:

ENSRNOP00000014684 ⟸ ENSRNOT00000014684

RefSeq Acc Id:	XP_038936585 ⟸ XM_039080657
- Peptide Label:	isoform X1
- UniProtKB:	Q505J9 (UniProtKB/Swiss-Prot), B3STU2 (UniProtKB/Swiss-Prot), A6I109 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936590 ⟸ XM_039080662
- Peptide Label:	isoform X1
- UniProtKB:	Q505J9 (UniProtKB/Swiss-Prot), B3STU2 (UniProtKB/Swiss-Prot), A6I109 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936599 ⟸ XM_039080671
- Peptide Label:	isoform X1
- UniProtKB:	Q505J9 (UniProtKB/Swiss-Prot), B3STU2 (UniProtKB/Swiss-Prot), A6I109 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038936607 ⟸ XM_039080679
- Peptide Label:	isoform X2

Protein Domains

AAA+ ATPase GST N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q505J9-F1-model_v2	AlphaFold	Q505J9	1-361	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308570	AgrOrtholog
BioCyc Gene	G2FUF-55911	BioCyc
Ensembl Genes	ENSRNOG00000010861	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014684.8	UniProtKB/TrEMBL
	ENSRNOT00000092063.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.60	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.1050.10	UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glutaredoxin	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7307334	IMAGE-MGC_LOAD
InterPro	AAA+_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AAA_lid_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_AAA_core	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_AAA_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glutathione-S-Trfase_C_sf	UniProtKB/TrEMBL
	Glutathione_S-Trfase_N	UniProtKB/TrEMBL
	GST_C	UniProtKB/TrEMBL
	Mito_OM_Translocase_MSP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:309532	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105686	IMAGE-MGC_LOAD
NCBI Gene	309532	ENTREZGENE
PANTHER	AAA ATPASE, PUTATIVE (AFU_ORTHOLOGUE AFUA_2G12920)-RELATED-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OUTER MITOCHONDRIAL TRANSMEMBRANE HELIX TRANSLOCASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AAA_lid_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GST_C	UniProtKB/TrEMBL
PhenoGen	Atad1	PhenoGen
PROSITE	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GST_NTER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010861	RatGTEx
SMART	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	GST_C_like	UniProtKB/TrEMBL
	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiordxn-like_fd	UniProtKB/TrEMBL
UniProt	A0A0H2UHI7_RAT	UniProtKB/TrEMBL
	A6I109	ENTREZGENE, UniProtKB/TrEMBL
	ATAD1_RAT	UniProtKB/Swiss-Prot
	B3STU2	ENTREZGENE
	Q505J9	ENTREZGENE
	Q7TP35_RAT	UniProtKB/TrEMBL
UniProt Secondary	B3STU2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Atad1	ATPase family, AAA domain containing 1	Atad1_predicted	ATPase family, AAA domain containing 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Atad1_predicted	ATPase family, AAA domain containing 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB