Advanced Search (OLGA)

Gene: Utp3 (UTP3, small subunit processome component) Rattus norvegicus

Analyze

Symbol:

Utp3

Name:

UTP3, small subunit processome component

RGD ID:

1308540

Description:

Predicted to be involved in brain development and maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located in nucleus. Predicted to be part of small-subunit processome. Predicted to be active in nucleolus. Orthologous to human UTP3 (UTP3 small subunit processome component); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

charged amino acid rich leucine zipper 1; charged amino acid-rich leucine zipper 1; Crlz1; disrupter of silencing SAS10; LOC305258; something about silencing protein 10; UTP3 homolog; UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae; UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae); UTP3, small subunit processome component homolog; UTP3, small subunit processome component homolog (S. cerevisiae)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UTP3 (UTP3 small subunit processome component)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Utp3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Utp3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UTP3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UTP3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Utp3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UTP3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UTP3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Utp3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Utp3 (UTP3 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GOLT1A (golgi transport 1A)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Utp3 (UTP3 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	UTP3 (UTP3 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	utp3 (UTP3 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T01B7.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T01B7.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SAS10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SAS10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Sas10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	utp3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	19,799,766 - 19,801,420 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	19,796,215 - 19,801,446 (-)	Ensembl				GRCr8
mRatBN7.2	14	19,515,716 - 19,517,370 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	19,515,669 - 19,517,396 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	19,505,128 - 19,506,782 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	20,823,988 - 20,825,642 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	19,526,822 - 19,528,476 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,153,998 - 21,155,652 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,154,000 - 21,155,652 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	21,063,825 - 21,065,479 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	21,095,959 - 21,097,613 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	18,854,363 - 18,856,017 (-)	NCBI		Celera
RGSC_v3.1	14	21,095,959 - 21,097,613 (-)	NCBI
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(S)-colchicine (ISO)

1,2-dichloroethane (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

5-fluorouracil (ISO)

adenine (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

disulfiram (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

flutamide (EXP)

FR900359 (ISO)

gentamycin (EXP)

hydroxyurea (ISO)

irinotecan (ISO)

kainic acid (ISO)

lipopolysaccharide (ISO)

lithium chloride (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methyl methanesulfonate (ISO)

mitomycin C (ISO)

niclosamide (ISO)

nitrates (ISO)

paracetamol (ISO)

phenol red (ISO)

potassium chromate (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

vinclozolin (EXP)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brain development (ISO,ISS)

chromatin organization (IEA)

maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (IBA)

ribosomal small subunit biogenesis (ISO,ISS)

Cellular Component

nucleolus (IBA,IEA,ISO)

nucleus (IEA,ISO,ISS)

small-subunit processome (IBA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11404095	PMID:12477932	PMID:15489334	PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Utp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	19,799,766 - 19,801,420 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	19,796,215 - 19,801,446 (-)	Ensembl				GRCr8
mRatBN7.2	14	19,515,716 - 19,517,370 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	19,515,669 - 19,517,396 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	19,505,128 - 19,506,782 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	20,823,988 - 20,825,642 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	19,526,822 - 19,528,476 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,153,998 - 21,155,652 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,154,000 - 21,155,652 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	21,063,825 - 21,065,479 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	21,095,959 - 21,097,613 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	18,854,363 - 18,856,017 (-)	NCBI		Celera
RGSC_v3.1	14	21,095,959 - 21,097,613 (-)	NCBI
Cytogenetic Map	14	p22	NCBI

UTP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	70,688,532 - 70,690,551 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	70,688,532 - 70,690,551 (+)	Ensembl			hg38	GRCh38
GRCh37	4	71,554,249 - 71,556,268 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	71,773,098 - 71,775,132 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	68,911,196 - 68,913,268 (+)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	67,358,059 - 67,360,131 (+)	NCBI		HuRef
CHM1_1	4	71,590,142 - 71,592,214 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	74,031,000 - 74,033,019 (+)	NCBI		T2T-CHM13v2.0

Utp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	88,702,321 - 88,703,949 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	88,702,321 - 88,703,949 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	88,554,462 - 88,556,090 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	88,554,462 - 88,556,090 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	88,983,508 - 88,985,108 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	89,629,044 - 89,630,644 (+)	NCBI		MGSCv36	mm8
Celera	5	86,702,669 - 86,704,269 (+)	NCBI		Celera
Cytogenetic Map	5	E1	NCBI
cM Map	5	43.74	NCBI

Utp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955447	2,290,981 - 2,292,405 (-)	Ensembl
ChiLan1.0	NW_004955447	2,290,916 - 2,292,419 (-)	NCBI	ChiLan1.0	ChiLan1.0

UTP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	59,391,435 - 59,393,564 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	59,586,424 - 59,588,553 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	53,530,782 - 53,532,877 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	59,877,381 - 59,879,491 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	59,877,815 - 59,879,254 (-)	Ensembl			panPan2	panpan1.1

UTP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	59,994,445 - 59,996,221 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	59,994,716 - 59,996,146 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	59,728,581 - 59,731,163 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	60,800,059 - 60,802,648 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	60,800,329 - 60,801,765 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	60,415,248 - 60,417,829 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	59,906,920 - 59,909,501 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	61,053,932 - 61,056,514 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Utp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	15,619,644 - 15,622,142 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936598	4,072,533 - 4,073,981 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936598	4,071,716 - 4,074,139 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UTP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	67,476,089 - 67,479,001 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	67,475,971 - 67,477,587 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	71,384,055 - 71,385,672 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UTP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	19,196,995 - 19,199,149 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	19,197,280 - 19,198,725 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666084	3,686,055 - 3,688,133 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Utp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624890	2,022,764 - 2,024,173 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624890	2,022,601 - 2,024,679 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Utp3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	2,044,677 - 2,046,334 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	218
Count of miRNA genes:	168
Interacting mature miRNAs:	189
Transcripts:	ENSRNOT00000004787
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3957878	21572472	Rat
631528	Scl11	Serum cholesterol level QTL 11	4.9		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	14	17875645	36079022	Rat
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9393298	39411170	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11334906	30674469	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	28389666	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3957878	31121464	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8621398	53621398	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18915454	42433608	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3957878	24886169	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18895192	63895192	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17906726	54251504	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1	31893212	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8621398	53621398	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	15137594	31238250	Rat

Markers in Region

AW557551

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	19,515,941 - 19,516,073 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	21,154,224 - 21,154,355	NCBI	Rnor6.0
Rnor_5.0	14	21,064,051 - 21,064,182	UniSTS	Rnor5.0
RGSC_v3.4	14	21,096,185 - 21,096,316	UniSTS	RGSC3.4
Celera	14	18,854,589 - 18,854,720	UniSTS
Cytogenetic Map	14	p22	UniSTS

C87704

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	14	19,799,898 - 19,800,011 (+)	Marker Load Pipeline
mRatBN7.2	14	19,515,847 - 19,515,961 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	21,154,130 - 21,154,243	NCBI	Rnor6.0
Rnor_5.0	14	21,063,957 - 21,064,070	UniSTS	Rnor5.0
RGSC_v3.4	14	21,096,091 - 21,096,204	UniSTS	RGSC3.4
Celera	14	18,854,495 - 18,854,608	UniSTS
Cytogenetic Map	14	p22	UniSTS

BE106508

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	19,515,735 - 19,515,925 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	21,154,018 - 21,154,207	NCBI	Rnor6.0
Rnor_5.0	14	21,063,845 - 21,064,034	UniSTS	Rnor5.0
RGSC_v3.4	14	21,095,979 - 21,096,168	UniSTS	RGSC3.4
Celera	14	18,854,383 - 18,854,572	UniSTS
RH 3.4 Map	14	285.3	UniSTS
Cytogenetic Map	14	p22	UniSTS

UniSTS:235209

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	19,515,807 - 19,516,073 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	21,154,090 - 21,154,355	NCBI	Rnor6.0
Rnor_5.0	14	21,063,917 - 21,064,182	UniSTS	Rnor5.0
RGSC_v3.4	14	21,096,051 - 21,096,316	UniSTS	RGSC3.4
Celera	14	18,854,455 - 18,854,720	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004787 ⟹ ENSRNOP00000004787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	19,515,669 - 19,517,396 (-)	Ensembl
Rnor_6.0 Ensembl	14	21,154,000 - 21,155,652 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000169955 ⟹ ENSRNOP00000110053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	19,796,215 - 19,801,446 (-)	Ensembl

RefSeq Acc Id:

NM_001012036 ⟹ NP_001012036

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	19,799,766 - 19,801,420 (-)	NCBI
mRatBN7.2	14	19,515,716 - 19,517,370 (-)	NCBI
Rnor_6.0	14	21,153,998 - 21,155,652 (-)	NCBI
Rnor_5.0	14	21,063,825 - 21,065,479 (-)	NCBI
RGSC_v3.4	14	21,095,959 - 21,097,613 (-)	RGD
Celera	14	18,854,363 - 18,856,017 (-)	RGD

Sequence:

show sequence

CACCCTGGGAGCGGAAGGAAATGGGCTTTTCCCAGACTCTGGGATCCGGTATTCACCAACTTGT
GTGGCGTGGAGCGTGGTGGTGCTGAAAACCTCCGGTTGCTGGAATCGTTTCTGCGCGGACATCA
GAAGTGGCGGAAATCGCGGCATCGCTGGGGAACCCGAGACCGCTGGTGAGCCATGGTGAAGCGA
TCACGGCGGCGTGGAGCGGCCCAGTGGGCCACCGTGCGGGCCAAGGCTGGTCGCACTGCCACGG
ACGAAAATGAGGACGATTTAGGGTCGCCGCCTTCTCCAGGGGACTCCAGCTACTACCAAGACCA
GGTAGATGAGTTCCATGAAGCGCGATCTCGGGCAGTCCTGGCTAAGGGCTGGAACGAAGTCGAG
AGTGGGGAGGAGGATGACGATGAGGAGGAAGAGGTGCTACCTCTAAATATTGACGATGAAAATG
ACGAAGATGGAGAGAGTTCCGAGGAGGAGGAGGATGGCGAAGATGATGATGGTGGGAGCTCCGT
ACAGAGTGAGGCTGAGGCCTCTGTGGATCCCAGCTTGTCCTGGGGTCAGAGAAAAAGGCTTTAT
TATGATACAGACTACGGTTCCAAATCCCGAGGCCGTCAGAGTCAGCAAGAAGTAGAAGAGGAGG
AAAGAGAGGAAGAAGAGGAGGCACAGGTAATTCAGCGGCGCTTAACCCAAGCCCTGCAAGAGGA
TGATTTTGGAGTCGCTTGGGTGGAGGCCTTTGCAAAACCCGTGCCACAAGTAGACGAAGCTGAG
ACTCGGGTTGTGAAGGATTTGGCTAAAGTCTCGGTAAAAGAGAAGCTGAAAATGTTGAGGAAAG
AGTCACCAGAGCTCTTAGAACTGATAGAAGACCTCAAAGTCAAGTTGACAGAAGTGAAGGATGA
GTTAGAGCCTTTGATACAGTTGGTGGAAAAGGGGGTCATTCCGCCTGGAAAAGGAAGCCAGTAC
CTGAAGACTAAGTATAACCTCTACTTGAATTATTGCGCCAACATCAGTTTTTATTTGATCTTAA
AAGCCAGGAGAGTCCCCGCACATGGACATCCTGTTATAGAAAGGCTTGTTACCTACAGAAATCT
GATCAACAAGCTCTCAGTTGTGGATCAGAAACTGTCCTCCGAAATCCGTCACCTACTCACAGCC
AAGGAGGGTGCTGGAAAGAAAGACCTGAATCCAAAAGCAAAATTAACCAAGACCAAGCCAAAGT
CTGCAAAGCAGACTGATGTTAACGCTGACCTGACTGAAGAGCCTGAGTTTGATGAGGCTGCACT
AGAGTTCTACAAGGAAATGGAAGACAGGCCAGAGTTGAAGAGAAAGAAAGAAGAAAATAGTGCT
GAAGAACAGGCTCTTGAAGAGCAAAACGCCAAGCGAGCCATTACCTACCAGATCGCCAAAAATA
GGGGACTTACACCCAGGAGAAAGAAGATTGATAGAAATCCCAGAGTCAAACATAGGGAAAAGTT
CCGAAGAGCCAAAATCCGAAGACGAGGCCAGGTTCGTGAAGTTCGTAGAGAAGAACAGCGGTAT
AGTGGTGAACTCTCTGGCATTCGCGCTGGAGTTAAAAAGAGCATTAAGCTTAAGTAAAGTTGCT
CTTAGGCCTAGCTTTTGCCACTTACCGTAGGTCAATAAAAGTGTTTTTGCAGTAAAAAAAAAAA
AAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012036	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79277	(Get FASTA)	NCBI Sequence Viewer
	EDL88517	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004787.1
	ENSRNOP00000110053
GenBank Protein	Q6AXX4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012036 ⟸ NM_001012036

- UniProtKB:

Q6AXX4 (UniProtKB/Swiss-Prot), A6KKJ3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVKRSRRRGAAQWATVRAKAGRTATDENEDDLGSPPSPGDSSYYQDQVDEFHEARSRAVLAKGW
NEVESGEEDDDEEEEVLPLNIDDENDEDGESSEEEEDGEDDDGGSSVQSEAEASVDPSLSWGQR
KRLYYDTDYGSKSRGRQSQQEVEEEEREEEEEAQVIQRRLTQALQEDDFGVAWVEAFAKPVPQV
DEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLIQLVEKGVIPPGK
GSQYLKTKYNLYLNYCANISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRH
LLTAKEGAGKKDLNPKAKLTKTKPKSAKQTDVNADLTEEPEFDEAALEFYKEMEDRPELKRKKE
ENSAEEQALEEQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRRE
EQRYSGELSGIRAGVKKSIKLK

hide sequence

Ensembl Acc Id:

ENSRNOP00000004787 ⟸ ENSRNOT00000004787

Ensembl Acc Id:

ENSRNOP00000110053 ⟸ ENSRNOT00000169955

Protein Domains

Sas10 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXX4-F1-model_v2	AlphaFold	Q6AXX4	1-470	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699242

Promoter ID:

EPDNEW_R9767

Type:

initiation region

Name:

Utp3_1

Description:

UTP3, small subunit processome component

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	21,155,598 - 21,155,658	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308540	AgrOrtholog
BioCyc Gene	G2FUF-16162	BioCyc
Ensembl Genes	ENSRNOG00000003599	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000080476	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000004787.4	UniProtKB/Swiss-Prot
	ENSRNOT00000169955	ENTREZGENE
IMAGE_CLONE	IMAGE:7134148	IMAGE-MGC_LOAD
InterPro	Sas10/Utp3/C1D	UniProtKB/Swiss-Prot
	Sas10_C_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:305258	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94402	IMAGE-MGC_LOAD
NCBI Gene	305258	ENTREZGENE
PANTHER	PTHR13237	UniProtKB/Swiss-Prot
	SOMETHING ABOUT SILENCING PROTEIN 10	UniProtKB/Swiss-Prot
Pfam	Sas10	UniProtKB/Swiss-Prot
	Sas10_Utp3	UniProtKB/Swiss-Prot
PhenoGen	Utp3	PhenoGen
RatGTEx	ENSRNOG00000003599	RatGTEx
	ENSRNOG00000080476	RatGTEx
UniProt	A6KKJ3	ENTREZGENE, UniProtKB/TrEMBL
	Q6AXX4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-06-12	Utp3	UTP3, small subunit processome component	Utp3	UTP3, small subunit processome component homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-01	Utp3	UTP3, small subunit processome component homolog (S. cerevisiae)	Utp3	UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29		UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)	Utp3	UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae	Name updated	1299863	APPROVED
2008-03-03	Utp3	UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae	Crlz1	charged amino acid rich leucine zipper 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Crlz1	charged amino acid rich leucine zipper 1	Crlz1_predicted	charged amino acid rich leucine zipper 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Crlz1_predicted	charged amino acid rich leucine zipper 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message