Advanced Search (OLGA)

Gene: Rtbdn (retbindin) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rtbdn

Name:

retbindin

RGD ID:

1308534

Description:

Predicted to enable riboflavin binding activity; riboflavin transmembrane transporter activity; and signaling receptor activity. Predicted to be involved in riboflavin transport. Predicted to be located in interphotoreceptor matrix. Predicted to be active in external side of plasma membrane. Orthologous to human RTBDN (retbindin); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Rtbnd

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RTBDN (retbindin)	RGD	RGD
Mus musculus (house mouse):	Rtbdn (retbindin)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Rtbdn (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RTBDN (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RTBDN (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rtbdn (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RTBDN (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RTBDN (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rtbdn (retbindin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRAV5 (T cell receptor alpha variable 5)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rtbdn (retbindin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RTBDN (retbindin)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,102,364 - 40,112,791 (-)	NCBI		GRCr8
mRatBN7.2	19	23,197,506 - 23,205,544 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,197,506 - 23,204,438 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,020,443 - 30,027,347 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,674,807 - 30,681,711 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,897,481 - 32,904,385 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,065,784 - 26,073,194 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,066,127 - 26,073,194 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	37,041,750 - 37,048,817 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,853,294 - 24,860,541 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,858,403 - 24,865,634 (-)	NCBI
Celera	19	22,754,995 - 22,761,858 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	Aicardi-Goutieres Syndrome 4		ISO	RTBDN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 4	ClinVar	PMID:10371528 more ...
Rtbdn	Rat	alpha-mannosidosis		ISO	RTBDN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of alpha-mannosidase	ClinVar	PMID:28492532
Rtbdn	Rat	Charcot-Marie-Tooth disease dominant intermediate B		ISO	RTBDN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate B	ClinVar	PMID:28492532
Rtbdn	Rat	episodic ataxia type 2		ISO	RTBDN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Episodic ataxia type 2	ClinVar	PMID:10371528 more ...
Rtbdn	Rat	glutaric acidemia I		ISO	RTBDN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glutaric aciduria and type 1	ClinVar	PMID:10371528 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	Ependymomas		ISO	RTBDN (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26075792

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Rtbdn (Mus musculus)	6480464	bisphenol S affects the methylation of RTBDN gene	CTD	PMID:31683443
Rtbdn	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of RTBDN mRNA	CTD	PMID:24780913 and PMID:25825206
Rtbdn	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of RTBDN mRNA	CTD	PMID:28959563
Rtbdn	Rat	benzo[a]pyrene	affects methylation	ISO	RTBDN (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of RTBDN exon and Benzo(a)pyrene affects the methylation of RTBDN promoter	CTD	PMID:27901495
Rtbdn	Rat	benzo[a]pyrene	increases methylation	ISO	RTBDN (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of RTBDN 3' UTR	CTD	PMID:27901495
Rtbdn	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RTBDN mRNA	CTD	PMID:25181051 and PMID:30816183
Rtbdn	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RTBDN mRNA	CTD	PMID:34947998
Rtbdn	Rat	CGP 52608	multiple interactions	ISO	RTBDN (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to RTBDN gene]	CTD	PMID:28238834
Rtbdn	Rat	choline	multiple interactions	ISO	Rtbdn (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RTBDN gene	CTD	PMID:20938992
Rtbdn	Rat	epoxiconazole	increases expression	ISO	Rtbdn (Mus musculus)	6480464	epoxiconazole results in increased expression of RTBDN mRNA	CTD	PMID:35436446
Rtbdn	Rat	ethylparaben	decreases expression	ISO	RTBDN (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of RTBDN mRNA	CTD	PMID:37690743
Rtbdn	Rat	folic acid	multiple interactions	ISO	Rtbdn (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RTBDN gene	CTD	PMID:20938992
Rtbdn	Rat	L-methionine	multiple interactions	ISO	Rtbdn (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RTBDN gene	CTD	PMID:20938992
Rtbdn	Rat	resveratrol	multiple interactions	ISO	RTBDN (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of RTBDN mRNA	CTD	PMID:23557933
Rtbdn	Rat	silicon dioxide	decreases methylation	ISO	RTBDN (Homo sapiens)	6480464	Silicon Dioxide results in decreased methylation of RTBDN gene	CTD	PMID:34973136
Rtbdn	Rat	titanium dioxide	decreases methylation	ISO	Rtbdn (Mus musculus)	6480464	titanium dioxide results in decreased methylation of RTBDN promoter alternative form	CTD	PMID:35295148
Rtbdn	Rat	triptonide	increases expression	ISO	Rtbdn (Mus musculus)	6480464	triptonide results in increased expression of RTBDN mRNA	CTD	PMID:33045310
Rtbdn	Rat	valproic acid	increases expression	ISO	RTBDN (Homo sapiens)	6480464	Valproic Acid results in increased expression of RTBDN mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	riboflavin transport	involved_in	IEA	GO:0032217	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	external side of plasma membrane	located_in	ISO	Rtbdn (Mus musculus)	1624291	PMID:25542898	RGD	PMID:25542898
Rtbdn	Rat	external side of plasma membrane	located_in	IEA	UniProtKB:Q8QZY4 and ensembl:ENSMUSP00000070558	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rtbdn	Rat	external side of plasma membrane	is_active_in	IBA	MGI:2443686 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rtbdn	Rat	interphotoreceptor matrix	located_in	ISO	Rtbdn (Mus musculus)	1624291	PMID:25542898	RGD	PMID:25542898
Rtbdn	Rat	interphotoreceptor matrix	located_in	IEA	UniProtKB:Q8QZY4 and ensembl:ENSMUSP00000070558	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rtbdn	Rat	riboflavin binding	enables	ISO	Rtbdn (Mus musculus)	1624291	PMID:25542898	RGD	PMID:25542898
Rtbdn	Rat	riboflavin binding	enables	IEA	UniProtKB:Q8QZY4 and ensembl:ENSMUSP00000070558	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rtbdn	Rat	riboflavin binding	enables	IBA	MGI:2443686 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rtbdn	Rat	riboflavin transmembrane transporter activity	enables	IBA	PANTHER:PTN000828825 and UniProtKB:P02752	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rtbdn	Rat	signaling receptor activity	enables	IBA	MGI:1929185 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:25542898

Rtbdn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,102,364 - 40,112,791 (-)	NCBI		GRCr8
mRatBN7.2	19	23,197,506 - 23,205,544 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,197,506 - 23,204,438 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,020,443 - 30,027,347 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,674,807 - 30,681,711 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,897,481 - 32,904,385 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,065,784 - 26,073,194 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,066,127 - 26,073,194 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	37,041,750 - 37,048,817 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,853,294 - 24,860,541 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,858,403 - 24,865,634 (-)	NCBI
Celera	19	22,754,995 - 22,761,858 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

RTBDN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	12,825,482 - 12,835,428 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	12,825,478 - 12,835,428 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	12,936,296 - 12,946,242 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,797,296 - 12,807,230 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	12,826,003 - 12,835,935 (-)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,507,931 - 12,517,838 (-)	NCBI		HuRef
CHM1_1	19	12,936,788 - 12,946,749 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	12,949,999 - 12,959,945 (-)	NCBI		T2T-CHM13v2.0

Rtbdn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,672,880 - 85,683,235 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,673,620 - 85,683,232 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	84,946,991 - 84,956,606 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,946,991 - 84,956,603 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,470,890 - 87,480,502 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,837,096 - 87,846,708 (+)	NCBI		MGSCv36	mm8
Celera	8	89,247,241 - 89,256,894 (+)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.37	NCBI

Rtbdn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,895,507 - 31,899,303 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,895,446 - 31,899,927 (-)	NCBI	ChiLan1.0	ChiLan1.0

RTBDN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	17,754,228 - 17,764,279 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	16,754,803 - 16,764,839 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,387,165 - 12,397,157 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,129,659 - 13,139,842 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,129,659 - 13,139,842 (-)	Ensembl	panpan1.1		panPan2

RTBDN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,324,843 - 49,337,226 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,334,127 - 49,337,223 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	49,208,281 - 49,211,342 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,842,790 - 49,856,059 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,852,996 - 49,856,053 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	49,064,229 - 49,067,287 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,490,490 - 49,493,537 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,733,105 - 49,736,167 (+)	NCBI		UU_Cfam_GSD_1.0

Rtbdn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,443,016 - 208,446,773 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	1,907,936 - 1,911,994 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	1,907,933 - 1,911,690 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RTBDN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	66,188,089 - 66,193,654 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	66,188,077 - 66,191,434 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,529,481 - 66,546,422 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RTBDN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,508,417 - 11,524,011 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666074	8,269,475 - 8,282,016 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rtbdn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624901	421,624 - 426,655 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rtbdn
31 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	85
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000064289
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat

RH140799

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,197,778 - 23,197,949 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	26,072,751 - 26,072,921	NCBI	Rnor6.0
Rnor_5.0	19	37,048,374 - 37,048,544	UniSTS	Rnor5.0
RGSC_v3.4	19	24,853,567 - 24,853,737	UniSTS	RGSC3.4
Celera	19	22,755,268 - 22,755,438	UniSTS
Cytogenetic Map	19	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	5	12	113	43	42	12	24	12	6	89	58	93	7	50	30


RefSeq Transcripts	NM_001107165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064289 ⟹ ENSRNOP00000063875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,197,506 - 23,204,438 (-)	Ensembl
Rnor_6.0 Ensembl	19	26,066,127 - 26,073,194 (+)	Ensembl

RefSeq Acc Id:

NM_001107165 ⟹ NP_001100635

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,102,364 - 40,109,295 (-)	NCBI
mRatBN7.2	19	23,197,506 - 23,204,438 (-)	NCBI
Rnor_6.0	19	26,066,127 - 26,073,194 (+)	NCBI
Rnor_5.0	19	37,041,750 - 37,048,817 (+)	NCBI
RGSC_v3.4	19	24,853,294 - 24,860,541 (-)	RGD
Celera	19	22,754,995 - 22,761,858 (-)	RGD

Sequence:

show sequence

TGGGGGGGCTGAAAAGAGTAAGAGGAAGTTCTGGGTAGAAGAGGGGCTTGGAAGAGCTGAGGGGGTCCTGTTACTCTAAAGGCAGTTGGCAGCAGAGGACAAACAGGGTGAGAGGTTGGTTGCCTGGG
AGTGGTGTTTAACCTGAGGAATGAAAGAATGGGAGGGGCTCTAGGGTGGGAATCCCCTAGCATTTGAAGAGCCCTTGGCCATTGGCTGGCATTCTCATCTATGGCCTGTCCTCTGTGCTGCCTGGCAA
CGATTTCTGGCGGGCAGCTACCAGTGACAACTTAAATCTCCAGAAGGAAGTCATCCCTCATCCCTCCACATCAGCTGGCTCTTGTCTCAGGTAGACATGGCCCACGAAGGCCACTTTCAACACAGCGG
GATGGTCTGGGCCCTGCGACTAATCCTGGCATGGGTCTTCTTGGTGACCTGTGGAGGGAGCCACCCACTGCAAGCCAGGTCCTGGGGACACCCTGGGCTGGCAGCCAACGTGAGCACAGGCCAGCTGC
AGCTAGCAGGGCACCCCCAGTCCTCGGTTCCACCATCTTACCCAAGGATCCAGGTTCCTAGTTCACAGACACCAGCAACGCCAGAACCTTGCTGTACTGCAGACATAGACAGACCAGAGGCATCAAAC
CCAGAGAGCCTTCTAGCCAGCTGCGGGGCACCAAGCCCAGAATGTGAATTCTTTCTGGGACACCTTCAACGAGCCCTCCGAGGTCGCTTTCACCCACTGCTGTTCGGAGTGCGCCGAATGCAGCCTCT
CTGCATGGAGCTCTGCCAGATTTGGTTCACCACCTGCCAAGCAGATTTTATTTGTGGCCCAACTTGGCTGCAGTCCTCTGGAAAGAGAGGCTGTGAGCCTAGCTGCCGTACCTATGGTCAGACTTTTG
CCAACGCCACAGATCTGTGTCACTCCGCTTTGGGTCATGCCCTGAGGGTGGCAGCTCCTGGCTCCAGTCATTGCTTCAACATCTCCATCTCCTCTCCAGGAGCCCGCCGCCGCCCTCGAGCCTGGATC
TCAAATGTTGCAGGCAGTGGCAGCGGCAGCGGCAGCGGCGACAGCCCGGAGTAGACGTTTGGCTTTCACTATAAATGTCCCTCCCCTAGGCCAGGAGCCACCCAGAGCCATCTCCCTCTCTTCCTCTC
TCCTTCCTTCCTAAACCGGGTCCTGGGGTTGCCTAGACAAGCCCTCCCACCGTTATCCTAGAAACATCCAACCCTGACTTACCTTGCTTTCCCCAAATAAAGTTGCCAGACTAAACCAGGCTATACAT
GGCTGCTGCTTGGGGGAAATACTTGGGGGAGAACCTGCCAAAAACGATAGTTTTAGAGAGGGAAAGGGAAGAACAGAGACCAGAGCACAGTACACAGGTCGACTCTGATGACCAACATTCTGTCCCCA
GAACTTACATGGTAGCAAAAGGAACAACTACAAGTTGTCCCCTGACCTCCAGGCTTGCCCTGGCACTTGTGTCCCCTCTCCCCCAAATAAATAAATAGATAAACT

hide sequence

RefSeq Acc Id:

XM_008772389 ⟹ XP_008770611

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,102,605 - 40,112,791 (-)	NCBI
mRatBN7.2	19	23,197,747 - 23,205,544 (-)	NCBI
Rnor_6.0	19	26,065,848 - 26,072,953 (+)	NCBI

Sequence:

show sequence

CTTGCTGGCCTTGGTTCGGTGGTTCTGAGGTGTCTCAGCATCCCCTAGACTCCAGCCTGCTAACAGGTGAGTGGCAGTGGGTAGGACGTCGAGAATCTTGTCTCCCATACTTTTACCTTCTTCTGCCC
AGAAGCTTTAGGACTCTAGGGGCAGAACCGCAGCCCTGCACAGTCCTGCTTGGTCCAACCCTGGGTGGAAGCTCCTAAGCCGATTGTGAAGATTGTGAACCGAGAGAAGACATGGCCCACGAAGGCCA
CTTTCAACACAGCGGGATGGTCTGGGCCCTGCGACTAATCCTGGCATGGGTCTTCTTGGTGACCTGTGGAGGGAGCCACCCACTGCAAGCCAGGTCCTGGGGACACCCTGGGCTGGCAGCCAACGTGA
GCACAGGCCAGCTGCAGCTAGCAGGGCACCCCCAGTCCTCGGTTCCACCATCTTACCCAAGGATCCAGGTTCCTAGTTCACAGACACCAGCAACGCCAGAACCTTGCTGTACTGCAGACATAGACAGA
CCAGAGGCATCAAACCCAGAGAGCCTTCTAGCCAGCTGCGGGGCACCAAGCCCAGAATGTGAATTCTTTCTGGGACACCTTCAACGAGCCCTCCGAGGTCGCTTTCACCCACTGCTGTTCGGAGTGCG
CCGAATGCAGCCTCTCTGCATGGAGCTCTGCCAGATTTGGTTCACCACCTGCCAAGCAGATTTTATTTGTGGCCCAACTTGGCTGCAGTCCTCTGGAAAGAGAGGCTGTGAGCCTAGCTGCCGTACCT
ATGGTCAGACTTTTGCCAACGCCACAGATCTGTGTCACTCCGCTTTGGGTCATGCCCTGAGGGTGGCAGCTCCTGGCTCCAGTCATTGCTTCAACATCTCCATCTCCTCTCCAGGAGCCCGCCGCCGC
CCTCGAGCCTGGATCTCAAATGTTGCAGGCAGTGGCAGCGGCAGCGGCAGCGGCGACAGCCCGGAGTAGACGTTTGGCTTTCACTATAAATGTCCCTCCCCTAGGCCAGGAGCCACCCAGAGCCATCT
CCCTCTCTTCCTCTCTCCTTCCTTCCTAAACCGGGTCCTGGGGTTGCCTAGACAAGCCCTCCCACCGTTATCCTAGAAACATCCAACCCTGACTTACCTTGCTTTCCCCAAATAAAGTTGCCAGACTA
AACCAGG

hide sequence

RefSeq Acc Id:

XM_039097682 ⟹ XP_038953610

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,102,605 - 40,109,296 (-)	NCBI
mRatBN7.2	19	23,197,747 - 23,205,544 (-)	NCBI


Protein RefSeqs	NP_001100635	(Get FASTA)	NCBI Sequence Viewer
	XP_008770611	(Get FASTA)	NCBI Sequence Viewer
	XP_038953610	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92183	(Get FASTA)	NCBI Sequence Viewer
	EDL92184	(Get FASTA)	NCBI Sequence Viewer
	EDL92185	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063875
	ENSRNOP00000063875.1

RefSeq Acc Id:	NP_001100635 ⟸ NM_001107165
- Peptide Label:	precursor
- UniProtKB:	D3ZWD2 (UniProtKB/TrEMBL), A6IY57 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAHEGHFQHSGMVWALRLILAWVFLVTCGGSHPLQARSWGHPGLAANVSTGQLQLAGHPQSSVPPSYPRIQVPSSQTPATPEPCCTADIDRPEASNPESLLASCGAPSPECEFFLGHLQRALRGRFHP LLFGVRRMQPLCMELCQIWFTTCQADFICGPTWLQSSGKRGCEPSCRTYGQTFANATDLCHSALGHALRVAAPGSSHCFNISISSPGARRRPRAWISNVAGSGSGSGSGDSPE hide sequence

RefSeq Acc Id:	XP_008770611 ⟸ XM_008772389
- Peptide Label:	isoform X1
- UniProtKB:	D3ZWD2 (UniProtKB/TrEMBL), A6IY57 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAHEGHFQHSGMVWALRLILAWVFLVTCGGSHPLQARSWGHPGLAANVSTGQLQLAGHPQSSVPPSYPRIQVPSSQTPATPEPCCTADIDRPEASNPESLLASCGAPSPECEFFLGHLQRALRGRFHP LLFGVRRMQPLCMELCQIWFTTCQADFICGPTWLQSSGKRGCEPSCRTYGQTFANATDLCHSALGHALRVAAPGSSHCFNISISSPGARRRPRAWISNVAGSGSGSGSGDSPE hide sequence

Ensembl Acc Id:

ENSRNOP00000063875 ⟸ ENSRNOT00000064289

RefSeq Acc Id:	XP_038953610 ⟸ XM_039097682
- Peptide Label:	isoform X2

Protein Domains

Folate receptor-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZWD2-F1-model_v2	AlphaFold	D3ZWD2	1-241	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-6132	BioCyc
Ensembl Genes	ENSRNOG00000043215	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064289	ENTREZGENE
	ENSRNOT00000064289.2	UniProtKB/TrEMBL
InterPro	Folate_rcpt	UniProtKB/TrEMBL
	Folate_rcpt_cons-reg	UniProtKB/TrEMBL
KEGG Report	rno:304667	UniProtKB/TrEMBL
NCBI Gene	304667	ENTREZGENE
PANTHER	Folt_rcpt	UniProtKB/TrEMBL
	RETBINDIN	UniProtKB/TrEMBL
Pfam	Folate_rec	UniProtKB/TrEMBL
PhenoGen	Rtbdn	PhenoGen
RatGTEx	ENSRNOG00000043215	RatGTEx
UniProt	A6IY57	ENTREZGENE, UniProtKB/TrEMBL
	D3ZWD2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Rtbdn	retbindin	Rtbnd_predicted	retbindin (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Rtbnd_predicted	retbindin (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD