Symbol:
Ogfrl1
Name:
opioid growth factor receptor-like 1
RGD ID:
1308498
Description:
Predicted to enable opioid growth factor receptor activity. Predicted to be located in membrane. Orthologous to human OGFRL1 (opioid growth factor receptor like 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC316290; MGC116379; opioid growth factor receptor-like protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 33,320,501 - 33,338,742 (-) NCBI GRCr8 mRatBN7.2 9 25,828,865 - 25,842,424 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 25,828,869 - 25,842,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 34,339,261 - 34,352,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 39,455,028 - 39,468,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 37,767,319 - 37,780,757 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 29,634,178 - 29,647,903 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 29,634,179 - 29,647,903 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 28,469,366 - 28,483,091 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 22,233,997 - 22,247,453 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 22,235,410 - 22,248,865 (-) NCBI Celera 9 23,376,302 - 23,389,627 (-) NCBI Celera Cytogenetic Map 9 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ogfrl1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1318301 6480464 1,2-Dimethylhydrazine results in increased expression of OGFRL1 mRNA CTD PMID:22206623 Ogfrl1 Rat 17beta-estradiol decreases expression ISO RGD:1318300 6480464 Estradiol results in decreased expression of OGFRL1 mRNA CTD PMID:21185374 Ogfrl1 Rat 17beta-estradiol decreases expression ISO RGD:1318301 6480464 Estradiol results in decreased expression of OGFRL1 mRNA CTD PMID:39298647 Ogfrl1 Rat 17beta-estradiol multiple interactions ISO RGD:1318300 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of OGFRL1 mRNA; more ... CTD PMID:20823114|PMID:30165855 Ogfrl1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1318300 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in decreased expression of OGFRL1 mRNA CTD PMID:19095052 Ogfrl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1318301 6480464 Tetrachlorodibenzodioxin affects the expression of OGFRL1 mRNA CTD PMID:21570461 Ogfrl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of OGFRL1 mRNA CTD PMID:34747641 Ogfrl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1318301 6480464 Tetrachlorodibenzodioxin results in decreased expression of OGFRL1 mRNA CTD PMID:26290441 Ogfrl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1318301 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression more ... CTD PMID:25975270 Ogfrl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1318300 6480464 Tetrachlorodibenzodioxin affects the expression of OGFRL1 mRNA CTD PMID:22574217 Ogfrl1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in increased expression of OGFRL1 mRNA CTD PMID:32109520 Ogfrl1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1318301 6480464 bisphenol S results in decreased expression of OGFRL1 mRNA CTD PMID:39298647 Ogfrl1 Rat 5-azacytidine increases expression ISO RGD:1318300 6480464 Azacitidine results in increased expression of OGFRL1 mRNA CTD PMID:20823114 Ogfrl1 Rat 5-fluorouracil affects response to substance ISO RGD:1318300 6480464 OGFRL1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ogfrl1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of OGFRL1 mRNA CTD PMID:31881176 Ogfrl1 Rat acrolein multiple interactions ISO RGD:1318300 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Ogfrl1 Rat aflatoxin B1 increases expression ISO RGD:1318301 6480464 Aflatoxin B1 results in increased expression of OGFRL1 mRNA CTD PMID:19770486 Ogfrl1 Rat aflatoxin B1 decreases methylation ISO RGD:1318300 6480464 Aflatoxin B1 results in decreased methylation of OGFRL1 gene CTD PMID:27153756 Ogfrl1 Rat all-trans-retinoic acid increases expression ISO RGD:1318300 6480464 Tretinoin results in increased expression of OGFRL1 mRNA CTD PMID:21934132|PMID:33167477 Ogfrl1 Rat all-trans-retinoic acid decreases expression ISO RGD:1318300 6480464 Tretinoin results in decreased expression of OGFRL1 mRNA CTD PMID:23724009 Ogfrl1 Rat alpha-pinene multiple interactions ISO RGD:1318300 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Ogfrl1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of OGFRL1 mRNA CTD PMID:30779732 Ogfrl1 Rat aristolochic acid A decreases expression ISO RGD:1318300 6480464 aristolochic acid I results in decreased expression of OGFRL1 mRNA CTD PMID:33212167 Ogfrl1 Rat Aroclor 1254 decreases expression ISO RGD:1318301 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of OGFRL1 mRNA CTD PMID:23650126 Ogfrl1 Rat arsane multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat arsenic atom multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat bisphenol A increases methylation ISO RGD:1318300 6480464 bisphenol A results in increased methylation of OGFRL1 gene CTD PMID:22576693 Ogfrl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of OGFRL1 mRNA CTD PMID:30816183|PMID:32528016 Ogfrl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OGFRL1 mRNA CTD PMID:25181051|PMID:32145629|PMID:34947998 Ogfrl1 Rat bisphenol A decreases expression ISO RGD:1318300 6480464 bisphenol A results in decreased expression of OGFRL1 mRNA CTD PMID:22576693|PMID:29275510 Ogfrl1 Rat bisphenol F decreases expression ISO RGD:1318301 6480464 bisphenol F results in decreased expression of OGFRL1 mRNA CTD PMID:38685157 Ogfrl1 Rat bucladesine multiple interactions ISO RGD:1318300 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of OGFRL1 mRNA CTD PMID:20823114 Ogfrl1 Rat butanal increases expression ISO RGD:1318300 6480464 butyraldehyde results in increased expression of OGFRL1 mRNA CTD PMID:26079696 Ogfrl1 Rat carbon nanotube increases expression ISO RGD:1318301 6480464 Nanotubes, Carbon analog results in increased expression of OGFRL1 mRNA CTD PMID:25554681 Ogfrl1 Rat carbon nanotube decreases expression ISO RGD:1318301 6480464 Nanotubes, Carbon results in decreased expression of OGFRL1 mRNA CTD PMID:25620056 Ogfrl1 Rat CGP 52608 multiple interactions ISO RGD:1318300 6480464 CGP 52608 promotes the reaction [RORA protein binds to OGFRL1 gene] CTD PMID:28238834 Ogfrl1 Rat cisplatin increases expression ISO RGD:1318300 6480464 Cisplatin results in increased expression of OGFRL1 mRNA CTD PMID:27594783 Ogfrl1 Rat cisplatin multiple interactions ISO RGD:1318300 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of OGFRL1 mRNA CTD PMID:27392435 Ogfrl1 Rat cisplatin decreases expression ISO RGD:1318300 6480464 Cisplatin results in decreased expression of OGFRL1 mRNA CTD PMID:27392435 Ogfrl1 Rat cobalt dichloride decreases expression ISO RGD:1318300 6480464 cobaltous chloride results in decreased expression of OGFRL1 mRNA CTD PMID:19320972 Ogfrl1 Rat copper atom multiple interactions ISO RGD:1318300 6480464 [NSC 689534 binds to Copper] which results in decreased expression of OGFRL1 mRNA CTD PMID:20971185 Ogfrl1 Rat copper(0) multiple interactions ISO RGD:1318300 6480464 [NSC 689534 binds to Copper] which results in decreased expression of OGFRL1 mRNA CTD PMID:20971185 Ogfrl1 Rat copper(II) sulfate decreases expression ISO RGD:1318300 6480464 Copper Sulfate results in decreased expression of OGFRL1 mRNA CTD PMID:19549813 Ogfrl1 Rat cyclosporin A increases expression ISO RGD:1318300 6480464 Cyclosporine results in increased expression of OGFRL1 mRNA CTD PMID:25562108 Ogfrl1 Rat dexamethasone increases expression ISO RGD:1318300 6480464 Dexamethasone results in increased expression of OGFRL1 mRNA CTD PMID:25047013 Ogfrl1 Rat Dibutyl phosphate affects expression ISO RGD:1318300 6480464 di-n-butylphosphoric acid affects the expression of OGFRL1 mRNA CTD PMID:37042841 Ogfrl1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of OGFRL1 mRNA CTD PMID:25152437 Ogfrl1 Rat dorsomorphin multiple interactions ISO RGD:1318300 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ogfrl1 Rat doxorubicin decreases expression ISO RGD:1318300 6480464 Doxorubicin results in decreased expression of OGFRL1 mRNA CTD PMID:29803840 Ogfrl1 Rat epoxiconazole increases expression ISO RGD:1318301 6480464 epoxiconazole results in increased expression of OGFRL1 mRNA CTD PMID:35436446 Ogfrl1 Rat ethyl methanesulfonate increases expression ISO RGD:1318300 6480464 Ethyl Methanesulfonate results in increased expression of OGFRL1 mRNA CTD PMID:23649840 Ogfrl1 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of OGFRL1 mRNA CTD PMID:37156404 Ogfrl1 Rat fluoranthene multiple interactions ISO RGD:1318301 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of OGFRL1 mRNA CTD PMID:28329830 Ogfrl1 Rat formaldehyde increases expression ISO RGD:1318300 6480464 Formaldehyde results in increased expression of OGFRL1 mRNA CTD PMID:23649840 Ogfrl1 Rat ivermectin decreases expression ISO RGD:1318300 6480464 Ivermectin results in decreased expression of OGFRL1 protein CTD PMID:32959892 Ogfrl1 Rat lead(0) affects expression ISO RGD:1318300 6480464 Lead affects the expression of OGFRL1 mRNA CTD PMID:28903495 Ogfrl1 Rat lipopolysaccharide multiple interactions ISO RGD:1318300 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of OGFRL1 mRNA CTD PMID:35811015 Ogfrl1 Rat lipopolysaccharide increases expression ISO RGD:1318300 6480464 Lipopolysaccharides results in increased expression of OGFRL1 mRNA CTD PMID:35811015 Ogfrl1 Rat manganese atom multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat manganese(0) multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat manganese(II) chloride multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat medroxyprogesterone acetate multiple interactions ISO RGD:1318300 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of OGFRL1 mRNA CTD PMID:20823114 Ogfrl1 Rat methyl methanesulfonate increases expression ISO RGD:1318300 6480464 Methyl Methanesulfonate results in increased expression of OGFRL1 mRNA CTD PMID:23649840 Ogfrl1 Rat methylmercury chloride decreases expression ISO RGD:1318300 6480464 methylmercuric chloride results in decreased expression of OGFRL1 mRNA CTD PMID:23179753|PMID:28001369 Ogfrl1 Rat methylmercury chloride increases expression ISO RGD:1318300 6480464 methylmercuric chloride results in increased expression of OGFRL1 mRNA CTD PMID:28001369 Ogfrl1 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1318300 6480464 1-Methyl-4-phenylpyridinium results in increased expression of OGFRL1 mRNA CTD PMID:24810058 Ogfrl1 Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of OGFRL1 mRNA CTD PMID:17412507 Ogfrl1 Rat nickel dichloride increases expression ISO RGD:1318300 6480464 nickel chloride results in increased expression of OGFRL1 mRNA CTD PMID:17312168 Ogfrl1 Rat ochratoxin A decreases expression ISO RGD:1318300 6480464 ochratoxin A results in decreased expression of OGFRL1 mRNA CTD PMID:30559759 Ogfrl1 Rat okadaic acid increases expression ISO RGD:1318300 6480464 Okadaic Acid results in increased expression of OGFRL1 mRNA CTD PMID:38832940 Ogfrl1 Rat ozone multiple interactions ISO RGD:1318300 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Ogfrl1 Rat ozone multiple interactions ISO RGD:1318301 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of OGFRL1 more ... CTD PMID:27106289 Ogfrl1 Rat paracetamol increases expression ISO RGD:1318300 6480464 Acetaminophen results in increased expression of OGFRL1 mRNA CTD PMID:29067470 Ogfrl1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of OGFRL1 mRNA CTD PMID:33387578 Ogfrl1 Rat phenobarbital multiple interactions ISO RGD:1318301 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of OGFRL1 mRNA] CTD PMID:19482888 Ogfrl1 Rat phenobarbital affects expression ISO RGD:1318301 6480464 Phenobarbital affects the expression of OGFRL1 mRNA CTD PMID:23091169 Ogfrl1 Rat phenobarbital affects expression ISO RGD:1318300 6480464 Phenobarbital affects the expression of OGFRL1 mRNA CTD PMID:19159669 Ogfrl1 Rat phenobarbital decreases expression ISO RGD:1318301 6480464 Phenobarbital results in decreased expression of OGFRL1 mRNA CTD PMID:19482888 Ogfrl1 Rat phenylmercury acetate increases expression ISO RGD:1318300 6480464 Phenylmercuric Acetate results in increased expression of OGFRL1 mRNA CTD PMID:26272509 Ogfrl1 Rat phenylmercury acetate multiple interactions ISO RGD:1318300 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ogfrl1 Rat pirinixic acid decreases expression ISO RGD:1318301 6480464 pirinixic acid results in decreased expression of OGFRL1 mRNA CTD PMID:23811191 Ogfrl1 Rat potassium chromate decreases expression ISO RGD:1318300 6480464 potassium chromate(VI) results in decreased expression of OGFRL1 mRNA CTD PMID:22714537 Ogfrl1 Rat quercetin decreases expression ISO RGD:1318300 6480464 Quercetin results in decreased expression of OGFRL1 mRNA CTD PMID:21632981 Ogfrl1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1318300 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of OGFRL1 mRNA CTD PMID:35811015 Ogfrl1 Rat SB 431542 multiple interactions ISO RGD:1318300 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ogfrl1 Rat silicon dioxide increases expression ISO RGD:1318300 6480464 Silicon Dioxide analog results in increased expression of OGFRL1 mRNA CTD PMID:25895662 Ogfrl1 Rat silicon dioxide decreases expression ISO RGD:1318301 6480464 Silicon Dioxide results in decreased expression of OGFRL1 mRNA CTD PMID:19073995 Ogfrl1 Rat sodium arsenite decreases methylation ISO RGD:1318301 6480464 sodium arsenite results in decreased methylation of OGFRL1 gene CTD PMID:32068019 Ogfrl1 Rat sodium arsenite multiple interactions ISO RGD:1318300 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Ogfrl1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of OGFRL1 mRNA CTD PMID:19281266 Ogfrl1 Rat succimer multiple interactions ISO RGD:1318301 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of OGFRL1 mRNA CTD PMID:21641980 Ogfrl1 Rat sunitinib increases expression ISO RGD:1318300 6480464 Sunitinib results in increased expression of OGFRL1 mRNA CTD PMID:31533062 Ogfrl1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of OGFRL1 mRNA CTD PMID:31150632 Ogfrl1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of OGFRL1 mRNA CTD PMID:34492290 Ogfrl1 Rat titanium dioxide decreases methylation ISO RGD:1318301 6480464 titanium dioxide results in decreased methylation of OGFRL1 promoter CTD PMID:35295148 Ogfrl1 Rat torcetrapib increases expression ISO RGD:1318300 6480464 torcetrapib results in increased expression of OGFRL1 mRNA CTD PMID:23228038 Ogfrl1 Rat trichostatin A increases expression ISO RGD:1318300 6480464 trichostatin A results in increased expression of OGFRL1 mRNA CTD PMID:24935251 Ogfrl1 Rat trichostatin A decreases expression ISO RGD:1318300 6480464 trichostatin A results in decreased expression of OGFRL1 mRNA CTD PMID:24935251 Ogfrl1 Rat triclosan increases expression ISO RGD:1318300 6480464 Triclosan results in increased expression of OGFRL1 mRNA CTD PMID:30510588 Ogfrl1 Rat triphenyl phosphate affects expression ISO RGD:1318300 6480464 triphenyl phosphate affects the expression of OGFRL1 mRNA CTD PMID:37042841 Ogfrl1 Rat trovafloxacin decreases expression ISO RGD:1318301 6480464 trovafloxacin results in decreased expression of OGFRL1 mRNA CTD PMID:35537566 Ogfrl1 Rat tungsten decreases expression ISO RGD:1318301 6480464 Tungsten results in decreased expression of OGFRL1 mRNA CTD PMID:30912803 Ogfrl1 Rat urethane increases expression ISO RGD:1318300 6480464 Urethane results in increased expression of OGFRL1 mRNA CTD PMID:28818685 Ogfrl1 Rat valproic acid decreases methylation ISO RGD:1318300 6480464 Valproic Acid results in decreased methylation of OGFRL1 gene CTD PMID:29154799 Ogfrl1 Rat valproic acid increases expression ISO RGD:1318300 6480464 Valproic Acid results in increased expression of OGFRL1 mRNA CTD PMID:23179753|PMID:24935251|PMID:28001369
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) acetamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (ISO) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) fentin chloride (EXP) fluoranthene (ISO) formaldehyde (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) medroxyprogesterone acetate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (EXP) nickel dichloride (ISO) ochratoxin A (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Ogfrl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 33,320,501 - 33,338,742 (-) NCBI GRCr8 mRatBN7.2 9 25,828,865 - 25,842,424 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 25,828,869 - 25,842,352 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 34,339,261 - 34,352,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 39,455,028 - 39,468,464 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 37,767,319 - 37,780,757 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 29,634,178 - 29,647,903 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 29,634,179 - 29,647,903 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 28,469,366 - 28,483,091 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 22,233,997 - 22,247,453 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 22,235,410 - 22,248,865 (-) NCBI Celera 9 23,376,302 - 23,389,627 (-) NCBI Celera Cytogenetic Map 9 q13 NCBI
OGFRL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 71,288,811 - 71,309,059 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 71,288,811 - 71,309,059 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 71,998,514 - 72,018,762 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 72,055,198 - 72,068,694 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 72,055,197 - 72,068,692 NCBI Celera 6 72,387,075 - 72,400,570 (+) NCBI Celera Cytogenetic Map 6 q13 NCBI HuRef 6 69,201,147 - 69,210,124 (+) NCBI HuRef CHM1_1 6 72,164,594 - 72,178,088 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 72,469,249 - 72,489,496 (+) NCBI T2T-CHM13v2.0
Ogfrl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 23,405,505 - 23,422,282 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 23,405,505 - 23,436,853 (-) Ensembl GRCm39 Ensembl GRCm38 1 23,366,424 - 23,383,201 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 23,366,424 - 23,397,772 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 23,373,263 - 23,390,014 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 23,320,699 - 23,337,450 (-) NCBI MGSCv36 mm8 Celera 1 23,209,220 - 23,225,831 (-) NCBI Celera Cytogenetic Map 1 A5 NCBI cM Map 1 9.57 NCBI
Ogfrl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955488 6,256,084 - 6,267,593 (+) NCBI ChiLan1.0 ChiLan1.0
OGFRL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 91,266,304 - 91,286,276 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 89,191,715 - 89,208,465 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 69,113,356 - 69,133,498 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 72,408,112 - 72,428,825 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 72,413,208 - 72,421,923 (+) Ensembl panpan1.1 panPan2
OGFRL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 33,678,706 - 33,697,193 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 33,678,411 - 33,690,598 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 33,536,247 - 33,556,073 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 34,217,492 - 34,237,341 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 34,217,507 - 34,235,492 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 33,753,000 - 33,772,911 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 33,790,792 - 33,810,676 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 33,901,842 - 33,921,659 (+) NCBI UU_Cfam_GSD_1.0
Ogfrl1
OGFRL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 51,313,016 - 51,332,327 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 51,312,988 - 51,332,331 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 57,650,902 - 57,670,235 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OGFRL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 3,751,671 - 3,766,288 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 3,735,366 - 3,765,296 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666058 9,699,804 - 9,720,021 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ogfrl1
.
Predicted Target Of
Count of predictions: 20 Count of miRNA genes: 20 Interacting mature miRNAs: 20 Transcripts: ENSRNOT00000019062 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 7207805 Bmd88 Bone mineral density QTL 88 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 9 23754024 58157242 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 724543 Cm20 Cardiac mass QTL 20 3.9 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 16961398 40594091 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 1598823 Memor16 Memory QTL 16 1.9 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 22133322 49968732 Rat
RH142962
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 25,831,639 - 25,831,810 (+) MAPPER mRatBN7.2 Rnor_6.0 9 29,636,951 - 29,637,121 NCBI Rnor6.0 Rnor_5.0 9 28,472,139 - 28,472,309 UniSTS Rnor5.0 RGSC_v3.4 9 22,236,770 - 22,236,940 UniSTS RGSC3.4 Celera 9 23,379,075 - 23,379,245 UniSTS RH 3.4 Map 9 244.2 UniSTS Cytogenetic Map 9 q13 UniSTS
RH143616
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 33,334,138 - 33,334,455 (+) Marker Load Pipeline mRatBN7.2 9 25,837,802 - 25,838,119 (+) MAPPER mRatBN7.2 Rnor_6.0 9 29,643,113 - 29,643,429 NCBI Rnor6.0 Rnor_5.0 9 28,478,301 - 28,478,617 UniSTS Rnor5.0 RGSC_v3.4 9 22,242,932 - 22,243,248 UniSTS RGSC3.4 Celera 9 23,385,237 - 23,385,551 UniSTS RH 3.4 Map 9 246.3 UniSTS Cytogenetic Map 9 q13 UniSTS
RH139012
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 25,831,628 - 25,831,830 (+) MAPPER mRatBN7.2 Rnor_6.0 9 29,636,940 - 29,637,141 NCBI Rnor6.0 Rnor_5.0 9 28,472,128 - 28,472,329 UniSTS Rnor5.0 RGSC_v3.4 9 22,236,759 - 22,236,960 UniSTS RGSC3.4 Celera 9 23,379,064 - 23,379,265 UniSTS Cytogenetic Map 9 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019062 ⟹ ENSRNOP00000019062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 25,828,869 - 25,842,352 (-) Ensembl Rnor_6.0 Ensembl 9 29,634,179 - 29,647,903 (-) Ensembl
RefSeq Acc Id:
NM_001025708 ⟹ NP_001020879
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 33,325,204 - 33,338,655 (-) NCBI mRatBN7.2 9 25,828,865 - 25,842,319 (-) NCBI Rnor_6.0 9 29,634,178 - 29,647,903 (-) NCBI Rnor_5.0 9 28,469,366 - 28,483,091 (-) NCBI RGSC_v3.4 9 22,233,997 - 22,247,453 (-) RGD Celera 9 23,376,302 - 23,389,627 (-) NCBI
Sequence:
CGTTGAGCTGTGCGGCGCGGGCCGGGCGAGCTGCCGCCTGCGCCCGAAGCGAGCGGAGCGCGGCCATGCCCGGGCCCTAGCGCGCTGCCGCAGCCCGCGCCCGCCGCCGCCTCTTCAATGGGCAACCT
hide sequence
RefSeq Acc Id:
XM_039083549 ⟹ XP_038939477
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 33,320,501 - 33,338,742 (-) NCBI mRatBN7.2 9 25,828,865 - 25,842,424 (-) NCBI
RefSeq Acc Id:
NP_001020879 ⟸ NM_001025708
- UniProtKB:
Q4KLH3 (UniProtKB/Swiss-Prot)
- Sequence:
MGNLLGGVSFREPTTVEDCDSTWQTDSEPEPEQPGPAGGGEGQEQDEREQPEQPPERAGGRPRASPVPEDHAEAAGAEQGGDSTEGNAKPKRSFYAARDLYKYRHQYPNFKDIRYQNDLSNLRFYKNK
hide sequence
Ensembl Acc Id:
ENSRNOP00000019062 ⟸ ENSRNOT00000019062
RefSeq Acc Id:
XP_038939477 ⟸ XM_039083549
- Peptide Label:
isoform X1
- UniProtKB:
F1M9G3 (UniProtKB/TrEMBL)
RGD ID: 13696579 Promoter ID: EPDNEW_R7104 Type: multiple initiation site Name: Ogfrl1_1 Description: opioid growth factor receptor-like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 29,647,936 - 29,647,996 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Ogfrl1
opioid growth factor receptor-like 1
Ogfrl1_predicted
opioid growth factor receptor-like 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ogfrl1_predicted
opioid growth factor receptor-like 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
