Advanced Search (OLGA)

Gene: Myl7 (myosin light chain 7) Rattus norvegicus

Analyze

Symbol:

Myl7

Name:

myosin light chain 7

RGD ID:

1308262

Description:

Predicted to enable calcium ion binding activity. Predicted to be involved in cardiac muscle tissue development and heart contraction. Predicted to be located in A band and dendritic spine. Predicted to be active in myofibril. Orthologous to human MYL7 (myosin light chain 7); INTERACTS WITH 3,7-dihydropurine-6-thione; 3H-1,2-dithiole-3-thione; amphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC289759; myosin regulatory light chain 2, atrial isoform; myosin, light chain 7, regulatory; myosin, light polypeptide 7, regulatory

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYL7 (myosin light chain 7)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Myl7 (myosin, light polypeptide 7, regulatory)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Myl7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYL7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYL7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myl7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MYL7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myl7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Myl7 (myosin light chain 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NUCKS1 (nuclear casein kinase and cyclin dependent kinase substrate 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MYL7 (myosin light chain 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Myl7 (myosin, light polypeptide 7, regulatory)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	myl7 (myosin, light chain 7, regulatory)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MLC2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Mlc2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	mlc-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	mlc-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	myl7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	myl7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ocm3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	84,994,644 - 84,997,173 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	84,993,736 - 84,997,372 (-)	Ensembl				GRCr8
mRatBN7.2	14	80,780,684 - 80,783,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	80,779,776 - 80,783,244 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	85,182,767 - 85,184,747 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	86,422,863 - 86,424,843 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	82,872,177 - 82,874,157 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	86,144,770 - 86,147,075 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	86,143,862 - 86,147,553 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	86,828,588 - 86,830,971 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	86,568,142 - 86,570,122 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	79,665,056 - 79,667,036 (-)	NCBI		Celera
RGSC_v3.1	14	86,587,287 - 86,590,077 (-)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Down syndrome (ISO)

hypertrophic cardiomyopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,7-dihydropurine-6-thione (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cobalt atom (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

cytarabine (ISO)

dextran sulfate (ISO)

dioxygen (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethylparaben (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

mercaptopurine (EXP)

methylmercury chloride (ISO)

ML-7 (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nitrofen (EXP)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

phenylephrine (ISO)

phenylmercury acetate (ISO)

purine-6-thiol (EXP)

SB 431542 (ISO)

serpentine asbestos (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

testosterone (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

wortmannin (ISO)

Y-27632 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle tissue development (IBA)

heart contraction (IBA)

Cellular Component

A band (IEA,ISO)

cytoplasm (IBA)

dendritic spine (IEA,ISO)

myofibril (IBA)

Molecular Function

calcium ion binding (IBA,IEA)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	An extra human chromosome 21 reduces mlc-2a expression in chimeric mice and Down syndrome.	Nishigaki R, etal., Biochem Biophys Res Commun. 2002 Jul 5;295(1):112-8.
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Recovery of skeletal muscle mass after extensive injury: positive effects of increased contractile activity.	Richard-Bulteau H, etal., Am J Physiol Cell Physiol. 2008 Feb;294(2):C467-76. Epub 2007 Dec 12.

Additional References at PubMed

PMID:12477932	PMID:15621049	PMID:15663482	PMID:35352799

Genomics

Comparative Map Data

Myl7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	84,994,644 - 84,997,173 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	84,993,736 - 84,997,372 (-)	Ensembl				GRCr8
mRatBN7.2	14	80,780,684 - 80,783,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	80,779,776 - 80,783,244 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	85,182,767 - 85,184,747 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	86,422,863 - 86,424,843 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	82,872,177 - 82,874,157 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	86,144,770 - 86,147,075 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	86,143,862 - 86,147,553 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	86,828,588 - 86,830,971 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	86,568,142 - 86,570,122 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	79,665,056 - 79,667,036 (-)	NCBI		Celera
RGSC_v3.1	14	86,587,287 - 86,590,077 (-)	NCBI
Cytogenetic Map	14	q21	NCBI

MYL7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	44,138,864 - 44,141,332 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	44,138,864 - 44,143,179 (-)	Ensembl			hg38	GRCh38
GRCh37	7	44,178,463 - 44,180,931 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	44,144,988 - 44,147,441 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	43,951,704 - 43,954,156	NCBI
Celera	7	44,276,421 - 44,278,875 (-)	NCBI		Celera
Cytogenetic Map	7	p13	NCBI
HuRef	7	44,063,733 - 44,066,187 (-)	NCBI		HuRef
CHM1_1	7	44,182,316 - 44,184,770 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	44,297,418 - 44,302,609 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	44,217,962 - 44,220,416 (-)	NCBI

Myl7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	5,846,637 - 5,848,782 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	5,846,637 - 5,848,782 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	5,896,637 - 5,898,782 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	5,896,637 - 5,898,782 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	5,796,640 - 5,798,785 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	5,796,639 - 5,798,782 (-)	NCBI		MGSCv36	mm8
Celera	11	6,388,472 - 6,390,617 (-)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	3.88	NCBI

Myl7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	7,840,078 - 7,842,129 (+)	Ensembl
ChiLan1.0	NW_004955456	7,840,078 - 7,842,065 (+)	NCBI	ChiLan1.0	ChiLan1.0

MYL7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	49,050,383 - 49,053,687 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	97,375,123 - 97,378,427 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	44,853,215 - 44,855,728 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	44,920,572 - 44,923,070 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	44,920,572 - 44,923,070 (-)	Ensembl			panPan2	panpan1.1

MYL7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	16	2,077,358 - 2,079,528 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	14,782,426 - 14,784,596 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	14,779,448 - 14,784,595 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	16	14,413,649 - 14,415,819 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	14,394,122 - 14,396,292 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Myl7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	99,888,255 - 99,892,579 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	19,100,029 - 19,102,199 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	19,099,991 - 19,101,985 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYL7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	14,526,045 - 14,528,498 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	14,525,637 - 14,528,513 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666062	7,986,634 - 7,992,117 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Myl7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	7,887,747 - 7,889,666 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	7,887,715 - 7,889,666 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Myl7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	74,853,315 - 74,856,103 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Myl7
27 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	83
Interacting mature miRNAs:	100
Transcripts:	ENSRNOT00000019335
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631213	Bw60	Body weight QTL60	4.51		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	84164970	100078267	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat

Markers in Region

RH130995

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	80,781,184 - 80,782,359 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	86,145,271 - 86,146,445	NCBI	Rnor6.0
Rnor_5.0	14	86,829,089 - 86,830,263	UniSTS	Rnor5.0
RGSC_v3.4	14	86,568,643 - 86,569,817	UniSTS	RGSC3.4
Celera	14	79,665,557 - 79,666,731	UniSTS
RH 3.4 Map	14	570.2	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	61	67	65	64	34	27	34	6	190	110	48	29	49	30	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006251216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019335 ⟹ ENSRNOP00000019335

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	84,993,736 - 84,997,372 (-)	Ensembl
mRatBN7.2 Ensembl	14	80,779,776 - 80,783,244 (-)	Ensembl
Rnor_6.0 Ensembl	14	86,143,862 - 86,146,744 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085847 ⟹ ENSRNOP00000072403

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	14	86,144,767 - 86,147,553 (-)	Ensembl

RefSeq Acc Id:

NM_001106017 ⟹ NP_001099487

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	84,994,644 - 84,996,624 (-)	NCBI
mRatBN7.2	14	80,780,684 - 80,782,664 (-)	NCBI
Rnor_6.0	14	86,144,770 - 86,146,750 (-)	NCBI
Rnor_5.0	14	86,828,588 - 86,830,971 (-)	NCBI
RGSC_v3.4	14	86,568,142 - 86,570,122 (-)	RGD
Celera	14	79,665,056 - 79,667,036 (-)	RGD

Sequence:

show sequence

ATTACAGGCCAGTAGGAAGGCTGGGACCCGGGGCAAGGCTGCAGCCACCAAGCAGGCTCAACGT
GGCTCTTCCAATGTCTTCTCAATGTTCGAGCAAGCCCAGATTCAGGAATTCAAGGAAGCCTTCA
GCTGCATTGACCAGAACAGAGACGGAATCATCTGCAAGTCAGACCTGAAGGAGACTTATTCCCA
GCTCGGGAGGGTAAGTGTCCCAGAGGAGGAGCTGGATGCCATGCTGCAAGAGGGGAAGGGCCCC
ATCAACTTCACCGTCTTCCTCACGCTCTTCGGGGAGAAACTCAATGGGACCGACCCTGAGGAGG
CCATCCTGAGTGCTTTCCGAATGTTTGACCCGAGCGGCCAGGGAGTTGTGAACAAGGAGGAGTT
CAAGCAGCTTCTCATGACCCAGGCAGACAAGTTCTCTCCTGCTGAGGTGGAGCAGCTGTTCGCC
CTGACACCCATGGACCTGACAGGCAACATCGACTACAAGTCTCTCTGCTACATCATCACCCACG
GGGATGAGAAAGAGGAGTAGAGACACACTGGGGTCACCTCAATAAACTCTGTGCCTGAACTGAA
C

hide sequence

RefSeq Acc Id:

XM_006251216 ⟹ XP_006251278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	84,994,645 - 84,997,173 (-)	NCBI
mRatBN7.2	14	80,780,685 - 80,783,259 (-)	NCBI
Rnor_6.0	14	86,144,771 - 86,147,075 (-)	NCBI
Rnor_5.0	14	86,828,588 - 86,830,971 (-)	NCBI

Sequence:

show sequence

TTTAGCCCAGTTATCCATTCCTCTCCTTATTTGGGCCTTTGGGTGATAAGGTTCAGACATAAAG
AGTCCAGTGACAAGATCATTCAGTCAGACCACTACGGACCATGGCCAGTAGGAAGGCTGGGACC
CGGGGCAAGGCTGCAGCCACCAAGCAGGCTCAACGTGGCTCTTCCAATGTCTTCTCAATGTTCG
AGCAAGCCCAGATTCAGGAATTCAAGGAAGCCTTCAGCTGCATTGACCAGAACAGAGACGGAAT
CATCTGCAAGTCAGACCTGAAGGAGACTTATTCCCAGCTCGGGAGGGTAAGTGTCCCAGAGGAG
GAGCTGGATGCCATGCTGCAAGAGGGGAAGGGCCCCATCAACTTCACCGTCTTCCTCACGCTCT
TCGGGGAGAAACTCAATGGGACCGACCCTGAGGAGGCCATCCTGAGTGCTTTCCGAATGTTTGA
CCCGAGCGGCCAGGGAGTTGTGAACAAGGAGGAGTTCAAGCAGCTTCTCATGACCCAGGCAGAC
AAGTTCTCTCCTGCTGAGGTGGAGCAGCTGTTCGCCCTGACACCCATGGACCTGACAGGCAACA
TCGACTACAAGTCTCTCTGCTACATCATCACCCACGGGGATGAGAAAGAGGAGTAGAGACACAC
TGGGGTCACCTCAATAAACTCTGTGCCTGAACTGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099487	(Get FASTA)	NCBI Sequence Viewer
	XP_006251278	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61995	(Get FASTA)	NCBI Sequence Viewer
	EDM00321	(Get FASTA)	NCBI Sequence Viewer
	EDM00322	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019335
	ENSRNOP00000019335.6

RefSeq Acc Id:	NP_001099487 ⟸ NM_001106017
- UniProtKB:	A6IKQ8 (UniProtKB/TrEMBL), B1WC41 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINFTVFL TLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLT GNIDYKSLCYIITHGDEKEE hide sequence

RefSeq Acc Id:	XP_006251278 ⟸ XM_006251216
- Peptide Label:	isoform X1
- UniProtKB:	F1M7K3 (UniProtKB/TrEMBL), B1WC41 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQL GRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFK QLLMTQADKFSPAEVEQLFALTPMDLTGNIDYKSLCYIITHGDEKEE hide sequence

Ensembl Acc Id:

ENSRNOP00000072403 ⟸ ENSRNOT00000085847

Ensembl Acc Id:

ENSRNOP00000019335 ⟸ ENSRNOT00000019335

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K2W5-F1-model_v2	AlphaFold	A0A0G2K2W5	1-175	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308262	AgrOrtholog
BioCyc Gene	G2FUF-15111	BioCyc
Ensembl Genes	ENSRNOG00000014409	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019335	ENTREZGENE
	ENSRNOT00000019335.8	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9034230	IMAGE-MGC_LOAD
InterPro	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
	Myosin_RLC	UniProtKB/TrEMBL
KEGG Report	rno:289759	UniProtKB/TrEMBL
MGC_CLONE	MGC:187830	IMAGE-MGC_LOAD
NCBI Gene	289759	ENTREZGENE
PANTHER	MYOSIN REGULATORY LIGHT CHAIN 2	UniProtKB/TrEMBL
Pfam	EF-hand_5	UniProtKB/TrEMBL
	EF-hand_7	UniProtKB/TrEMBL
PhenoGen	Myl7	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014409	RatGTEx
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A6IKQ8	ENTREZGENE, UniProtKB/TrEMBL
	B1WC41	ENTREZGENE, UniProtKB/TrEMBL
	F1M7K3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-10	Myl7	myosin light chain 7	Myl7	myosin, light chain 7, regulatory	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Myl7	myosin, light chain 7, regulatory	Myl7	myosin, light polypeptide 7, regulatory	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Myl7	myosin, light polypeptide 7, regulatory	Myl7_predicted	myosin, light polypeptide 7, regulatory (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Myl7_predicted	myosin, light polypeptide 7, regulatory (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD