Advanced Search (OLGA)

Gene: Ado (2-aminoethanethiol dioxygenase) Rattus norvegicus

Analyze

Symbol:

Ado

Name:

2-aminoethanethiol dioxygenase

RGD ID:

1308233

Description:

Predicted to enable cysteamine dioxygenase activity and iron ion binding activity. Predicted to be involved in cellular response to hypoxia. Orthologous to human ADO (2-aminoethanethiol dioxygenase); PARTICIPATES IN taurine and hypotaurine metabolic pathway; INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-aminoethanethiol (cysteamine) dioxygenase; LOC309732; RGD1308233; similar to hypothetical protein FLJ14547

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADO (2-aminoethanethiol dioxygenase)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Ado (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ado (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADO (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADO (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ado (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADO (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADO (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ado (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ado (2-aminoethanethiol dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ADO (2-aminoethanethiol dioxygenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADO (2-aminoethanethiol dioxygenase)	Alliance	DIOPT (HGNC)
Mus musculus (house mouse):	Ado (2-aminoethanethiol dioxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adob (2-aminoethanethiol (cysteamine) dioxygenase b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adoa (2-aminoethanethiol (cysteamine) dioxygenase a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7550	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y50D4C.6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ado	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	21,043,317 - 21,048,483 (+)	Ensembl				GRCr8
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	21,768,994 - 21,770,162 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,122,055 - 21,123,223 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,599,535 - 21,600,703 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	22,406,218 - 22,407,386 (+)	NCBI		Celera
RGSC_v3.1	20	21,835,054 - 21,892,516 (+)	NCBI
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

deguelin (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

indometacin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

nitrofen (EXP)

paracetamol (EXP)

phenobarbital (EXP)

picoxystrobin (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hypoxia (IEA,ISO)

Cellular Component

mitochondrion (ISO)

Molecular Function

cysteamine dioxygenase activity (IEA,ISO)

iron ion binding (IEA,ISO)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

taurine and hypotaurine metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:34800366

Genomics

Comparative Map Data

Ado
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	21,043,317 - 21,048,483 (+)	Ensembl				GRCr8
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	21,768,994 - 21,770,162 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,122,055 - 21,123,223 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,599,535 - 21,600,703 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	22,406,218 - 22,407,386 (+)	NCBI		Celera
RGSC_v3.1	20	21,835,054 - 21,892,516 (+)	NCBI
Cytogenetic Map	20	p11	NCBI

ADO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	62,804,720 - 62,808,479 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	62,804,720 - 62,808,479 (+)	Ensembl			hg38	GRCh38
GRCh37	10	64,564,480 - 64,568,239 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	64,234,522 - 64,238,245 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	64,234,651 - 64,238,244	NCBI
Celera	10	57,831,785 - 57,835,508 (+)	NCBI		Celera
Cytogenetic Map	10	q21.3	NCBI
HuRef	10	58,556,298 - 58,560,021 (+)	NCBI		HuRef
CHM1_1	10	64,846,508 - 64,850,231 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	63,662,863 - 63,666,622 (+)	NCBI		T2T-CHM13v2.0

Ado
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	67,380,341 - 67,384,785 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	67,380,341 - 67,384,898 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	67,544,511 - 67,548,955 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	67,544,511 - 67,549,068 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	67,007,259 - 67,011,703 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	66,940,488 - 66,944,299 (-)	NCBI		MGSCv36	mm8
Celera	10	68,635,994 - 68,640,438 (-)	NCBI		Celera
Cytogenetic Map	10	B5.1	NCBI
cM Map	10	34.96	NCBI

Ado
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	16,049,284 - 16,050,096 (+)	Ensembl
ChiLan1.0	NW_004955425	16,049,194 - 16,052,275 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	74,987,624 - 74,994,534 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	74,996,097 - 74,999,868 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	59,312,788 - 59,316,554 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	61,641,371 - 61,644,848 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

ADO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	14,698,582 - 14,702,635 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	14,698,616 - 14,699,428 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	14,915,996 - 14,920,120 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	14,962,585 - 14,966,710 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	14,962,691 - 14,963,503 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	14,945,248 - 14,949,371 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	15,070,279 - 15,074,404 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	15,425,875 - 15,430,000 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ado
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	66,391,222 - 66,394,926 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936753	1,968,401 - 1,969,213 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936753	1,965,840 - 1,969,554 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	66,277,947 - 66,278,759 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	66,277,224 - 66,281,964 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	71,509,996 - 71,514,349 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	68,483,110 - 68,486,866 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	68,485,720 - 68,486,532 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	29,367,071 - 29,371,016 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ado
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	965,433 - 966,245 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624791	962,840 - 966,603 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ado
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	19,283,241 - 19,284,746 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ado
5 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	221
Count of miRNA genes:	156
Interacting mature miRNAs:	181
Transcripts:	ENSRNOT00000000791
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8043920	29865039	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	20745585	56021148	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1598870	Bp289	Blood pressure QTL 289	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	8216359	53216359	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
1598858	Cm61	Cardiac mass QTL 61	3.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	20	8216359	53216359	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	12243242	49189476	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH138042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	21,043,642 - 21,043,780 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	22,446,820 - 22,446,957	NCBI	Rnor6.0
Rnor_5.0	20	24,544,199 - 24,544,336	UniSTS	Rnor5.0
RGSC_v3.4	20	21,876,230 - 21,876,367	UniSTS	RGSC3.4
Celera	20	22,404,986 - 22,405,123	UniSTS
Cytogenetic Map	20	p11	UniSTS

RH139021

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	20	21,044,259 - 21,044,536 (+)	Marker Load Pipeline
mRatBN7.2	20	21,045,380 - 21,045,657 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	22,448,574 - 22,448,850	NCBI	Rnor6.0
Rnor_5.0	20	24,545,701 - 24,545,977	UniSTS	Rnor5.0
RGSC_v3.4	20	21,878,012 - 21,878,288	UniSTS	RGSC3.4
Celera	20	22,406,784 - 22,407,060	UniSTS
RH 3.4 Map	4	701.2	UniSTS
Cytogenetic Map	20	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	160	91	90	59	87	59	6	349	186	11	139	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097613 ⟹ ENSRNOP00000083299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	21,043,317 - 21,048,483 (+)	Ensembl
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl

RefSeq Acc Id:

NM_001107626 ⟹ NP_001101096

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	RGD
Celera	20	22,406,218 - 22,407,386 (+)	NCBI

Sequence:

show sequence

CGGAGACCGCAAGGGGCGGCGCAGAGGCGGAACGGGCCGGCCGCGAGCCGCGCAGGAAGCGCCA
AGCATGCCCCGCGACAACATGGCCTCCCTGATCCAGCGCATCGCTCGCCAGGCTTGTCTCACCT
TCCGCGGCGGCTCGACGGGCTCCGAGGCGCCAGCACCCGGCTTCCCGGAGAACCTGAGCCAGCT
CAAGAGCCTGCTGACCCAGGTTCGCGCCGAAGACCTCAACATCGCACCGCGCAAGGCGCTGCCG
CAACCTCTGCCGCGGAACCTCCCGCCGGTCACTTACATGCACATCTACGAGACGGAGGGCTTCA
GCCTGGGCGTGTTCCTGCTCAAGAGCGGTACGTGCATCCCGCTGCACGACCACCCGGGCATGCA
CGGTATGCTCAAGGTGCTGTACGGCAAGGTCCGCATCAGCTGCATGGACAAGCTGGACACGGGG
GCCGTGCATCGGCGGCCGCCGCCTGAACAGCAGTTCGAGCCCCCGCTGCAACCTACGGAGAGGG
AGGCCGTGCGACTGGGCGTACTGCGCTCCCGGGCCGAGTACACCGAAGCCAGTGGTCCCTGCGT
ACTCACTCCACACCGGGACAACCTGCACCAGATTGATGCGGTGGACGGGCCAGCCGCCTTCCTG
GACATCCTGGCCCCACCCTACGACCCGGAGGACGGCCGGGACTGCCACTATTACCGTGTGATGG
AGCCCATCAAACCCAAGGAGGCTTCCGGCTCTGCCTGCGACCTTCCCCGAGAAGTATGGCTCCT
GGAGACCCCACAGGCCGACGACTTCTGGTGCGAGGGAGAGCCCTATCCAGGCCCCAAAGTCCTA
CCCTGAAGCTCCTGCCGCCCGGGAACTGTGGGCCCTCTCTACCTACCATAAGGGCTCTTCTCTC
TCTGTCCCCTCGCCTGGACGATGGATTTACTGAAATGACCAGCGCCACGTCTTGAGCAACCTTG
GGGAGCACGGCCCACTGGAGTATAGCCACCACCGGGCACGGTTATGGGGGCGGGTGGGCGGGAG
GCTAGGTTGATTCCTGGTTTTGTCACTGCCACCAAGGCTTTGATTTAAAGGAAAGGGGCAGGGA
CCCTAAAGCGCTTCCACCGTAAAGCCATAAGGAAAACAGTTTGGTTTTCATTCTCTACAAAATA
CACTAAGTGATTTTGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101096	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL97324	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000083299
	ENSRNOP00000083299.1

RefSeq Acc Id:

NP_001101096 ⟸ NM_001107626

- UniProtKB:

A0A8I5ZWY4 (UniProtKB/TrEMBL), A6JKV8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPRDNMASLIQRIARQACLTFRGGSTGSEAPAPGFPENLSQLKSLLTQVRAEDLNIAPRKALPQ
PLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGKVRISCMDKLDTGA
VHRRPPPEQQFEPPLQPTEREAVRLGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLD
ILAPPYDPEDGRDCHYYRVMEPIKPKEASGSACDLPREVWLLETPQADDFWCEGEPYPGPKVLP

hide sequence

Ensembl Acc Id:

ENSRNOP00000083299 ⟸ ENSRNOT00000097613

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308233	AgrOrtholog
BioCyc Gene	G2FUF-3871	BioCyc
BioCyc Pathway	PWY-7850 [taurine biosynthesis II]	BioCyc
BioCyc Pathway Image	PWY-7850	BioCyc
Ensembl Genes	ENSRNOG00000000639	Ensembl
	ENSRNOG00000070733	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000097613	ENTREZGENE
	ENSRNOT00000097613.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.10	UniProtKB/TrEMBL
InterPro	PCO/ADO	UniProtKB/TrEMBL
	RmlC-like_jellyroll	UniProtKB/TrEMBL
	RmlC_Cupin_sf	UniProtKB/TrEMBL
KEGG Report	rno:309732	UniProtKB/TrEMBL
NCBI Gene	309732	ENTREZGENE
PANTHER	2-AMINOETHANETHIOL DIOXYGENASE	UniProtKB/TrEMBL
	PTHR22966	UniProtKB/TrEMBL
Pfam	PCO_ADO	UniProtKB/TrEMBL
PhenoGen	Ado	PhenoGen
RatGTEx	ENSRNOG00000000639	RatGTEx
	ENSRNOG00000070733	RatGTEx
Superfamily-SCOP	SSF51182	UniProtKB/TrEMBL
UniProt	A0A8I5ZWY4	ENTREZGENE, UniProtKB/TrEMBL
	A6JKV8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-08	Ado	2-aminoethanethiol dioxygenase	Ado	2-aminoethanethiol (cysteamine) dioxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-26	Ado	2-aminoethanethiol (cysteamine) dioxygenase	RGD1308233_predicted	similar to hypothetical protein FLJ14547 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1308233_predicted	similar to hypothetical protein FLJ14547 (predicted)	LOC309732_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC309732_predicted	similar to hypothetical protein FLJ14547 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways