Advanced Search (OLGA)

Gene: Prelid1 (PRELI domain containing 1) Rattus norvegicus

Analyze

Symbol:

Prelid1

Name:

PRELI domain containing 1

RGD ID:

1308082

Description:

Orthologous to human PRELID1 (PRELI domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; rotenone.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC290995; MGC109157; Preli; PRELI domain-containing protein 1, mitochondrial; protein of relevant evolutionary and lymphoid interest; RGD1308082; similar to px19-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRELID1 (PRELI domain containing 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Prelid1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prelid1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRELID1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRELID1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prelid1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRELID1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRELID1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prelid1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Prelid1 (PRELI domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CDKL2 (cyclin dependent kinase like 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Prelid1 (PRELI domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PRELID1 (PRELI domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	PRELID1 (PRELI domain containing 1)	Alliance	DIOPT (HGNC)
Danio rerio (zebrafish):	prelid1a (PRELI domain containing 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	B0334.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UPS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	prel	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prelid1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	9,310,471 - 9,313,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	9,310,472 - 9,313,531 (-)	Ensembl				GRCr8
mRatBN7.2	17	9,305,349 - 9,308,389 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	9,305,361 - 9,308,407 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	9,321,771 - 9,324,793 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	10,850,905 - 10,853,935 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	9,318,163 - 9,321,185 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,834,245 - 9,837,285 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,834,242 - 9,837,303 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	11,943,925 - 11,946,965 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	15,350,084 - 15,353,124 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	9,383,719 - 9,386,759 (-)	NCBI		Celera
RGSC_v3.1	17	15,350,084 - 15,353,124 (-)	NCBI
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

fluoranthene (ISO)

folic acid (ISO)

nickel atom (ISO)

nitrates (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

thioacetamide (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of apoptotic process (ISO)

negative regulation of mitochondrial membrane potential (ISO)

negative regulation of release of cytochrome c from mitochondria (ISO)

positive regulation of cellular respiration (ISO)

positive regulation of endopeptidase activity (ISO)

positive regulation of phospholipid transport (ISO)

positive regulation of T cell apoptotic process (ISO)

regulation of membrane lipid distribution (ISO)

regulation of mitochondrial membrane potential (ISO)

regulation of T cell differentiation (ISO)

Cellular Component

mitochondrial intermembrane space (IEA,ISO)

mitochondrion (ISO)

protein-containing complex (ISO)

Molecular Function

phosphatidic acid transfer activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14640972	PMID:18945965	PMID:21364629	PMID:23931759

Genomics

Comparative Map Data

Prelid1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	9,310,471 - 9,313,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	9,310,472 - 9,313,531 (-)	Ensembl				GRCr8
mRatBN7.2	17	9,305,349 - 9,308,389 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	9,305,361 - 9,308,407 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	9,321,771 - 9,324,793 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	10,850,905 - 10,853,935 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	9,318,163 - 9,321,185 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,834,245 - 9,837,285 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,834,242 - 9,837,303 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	11,943,925 - 11,946,965 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	15,350,084 - 15,353,124 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	9,383,719 - 9,386,759 (-)	NCBI		Celera
RGSC_v3.1	17	15,350,084 - 15,353,124 (-)	NCBI
Cytogenetic Map	17	p14	NCBI

PRELID1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	177,303,799 - 177,306,949 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	177,303,790 - 177,306,949 (+)	Ensembl			hg38	GRCh38
GRCh37	5	176,730,800 - 176,733,950 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	176,663,441 - 176,666,556 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	5	171,767,411 - 171,770,526 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	171,651,496 - 171,654,693 (+)	NCBI		HuRef
CHM1_1	5	176,163,805 - 176,167,002 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	177,847,033 - 177,850,183 (+)	NCBI		T2T-CHM13v2.0

Prelid1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	55,469,868 - 55,473,085 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	55,468,313 - 55,473,085 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	55,322,055 - 55,325,272 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	55,320,500 - 55,325,272 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	55,423,416 - 55,426,633 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	55,331,677 - 55,334,894 (+)	NCBI		MGSCv36	mm8
Celera	13	56,377,635 - 56,380,852 (+)	NCBI		Celera
Cytogenetic Map	13	B1	NCBI
cM Map	13	29.8	NCBI

Prelid1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	29,551,424 - 29,554,436 (+)	Ensembl
ChiLan1.0	NW_004955408	29,551,253 - 29,554,778 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRELID1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	172,388,273 - 172,391,183 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	170,527,817 - 170,531,020 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	172,605,767 - 172,608,901 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	179,669,885 - 179,672,965 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	179,669,885 - 179,672,965 (+)	Ensembl			panPan2	panpan1.1

PRELID1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	36,051,562 - 36,055,080 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	36,051,879 - 36,055,043 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	36,018,812 - 36,022,360 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	36,417,712 - 36,421,263 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	36,415,768 - 36,421,243 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	36,242,812 - 36,246,365 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	36,429,004 - 36,432,549 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	36,938,555 - 36,942,105 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prelid1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	122,555,946 - 122,559,538 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936597	1,580,850 - 1,584,445 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936597	1,580,849 - 1,584,445 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRELID1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	80,641,845 - 80,653,670 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	80,641,844 - 80,646,390 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	82,222,450 - 82,226,996 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRELID1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	79,313,442 - 79,316,788 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	10,501,769 - 10,505,238 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prelid1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	12,774,737 - 12,778,131 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	12,774,456 - 12,778,174 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prelid1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	73,646,732 - 73,649,802 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prelid1
10 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	55
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000022134
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4360057	27233623	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9206505	23859062	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9206505	23859062	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	1	22181410	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	1	21499218	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7985243	16523460	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	8574342	32199534	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9206505	23859062	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4360057	27233623	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2120843	22087569	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22877318	Rat

Markers in Region

RH128304

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,305,350 - 9,305,534 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,834,247 - 9,834,430	NCBI	Rnor6.0
Rnor_5.0	17	11,943,927 - 11,944,110	UniSTS	Rnor5.0
RGSC_v3.4	17	15,350,086 - 15,350,269	UniSTS	RGSC3.4
Celera	17	9,383,721 - 9,383,904	UniSTS
RH 3.4 Map	17	80.0	UniSTS
Cytogenetic Map	17	p14	UniSTS

RH131590

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,304,932 - 9,305,132 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,833,829 - 9,834,028	NCBI	Rnor6.0
Rnor_5.0	17	11,943,509 - 11,943,708	UniSTS	Rnor5.0
RGSC_v3.4	17	15,349,668 - 15,349,867	UniSTS	RGSC3.4
Celera	17	9,383,303 - 9,383,502	UniSTS
RH 3.4 Map	17	77.9	UniSTS
Cytogenetic Map	17	p14	UniSTS

RH134116

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	9,305,636 - 9,306,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,834,533 - 9,834,996	NCBI	Rnor6.0
Rnor_5.0	17	11,944,213 - 11,944,676	UniSTS	Rnor5.0
RGSC_v3.4	17	15,350,372 - 15,350,835	UniSTS	RGSC3.4
Celera	17	9,384,007 - 9,384,470	UniSTS
RH 3.4 Map	1	1536.9	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	1	56	145	64	60	48	73	48	6	282	151	11	132	70	81	12	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009636	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022134 ⟹ ENSRNOP00000022134

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	9,310,472 - 9,313,531 (-)	Ensembl
mRatBN7.2 Ensembl	17	9,305,361 - 9,308,407 (+)	Ensembl
Rnor_6.0 Ensembl	17	9,834,245 - 9,837,297 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	9,835,988 - 9,837,303 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091320 ⟹ ENSRNOP00000070144

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	9,834,242 - 9,837,293 (-)	Ensembl

RefSeq Acc Id:

NM_001009636 ⟹ NP_001009636

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	9,310,471 - 9,313,511 (-)	NCBI
mRatBN7.2	17	9,305,349 - 9,308,389 (-)	NCBI
Rnor_6.0	17	9,834,245 - 9,837,285 (-)	NCBI
Rnor_5.0	17	11,943,925 - 11,946,965 (-)	NCBI
RGSC_v3.4	17	15,350,084 - 15,353,124 (-)	RGD
Celera	17	9,383,719 - 9,386,759 (-)	RGD

Sequence:

show sequence

GGCGGCGGTAGGGACCTGGGCGCGGCGCCGCGGTGATTGAGCTGCGAGCCTGGCGGGCGTGCGC
CTTGCCACGTGCCCTCCCCACCCCCGGGCTCTTCACCCTGATGCTGCACGGGTGCTGAGCCCGC
CCGGGTCGGGACGATGGTGAAGTATTTCCTGGGCCAGAGCGTGCTCCGAAGTTCCTGGGACCAA
GTGTTCGCTGCCTTCTGGCAACGGTACCCGAATCCCTATAGCAAACATGTCTTAACCGAAGACA
TAGTGCACCGGGAGGTGACCCCTGACCAGAAGCTTCTGTCCCGGAGACTCCTGACCAAGACCAA
CAGGATGCCACGTTGGGCAGAGCGACTGTTTCCCGCCAACGTTGCTCACTCGGTGTACATCCTG
GAGGACTCGATTGTGGACCCACAGAATCAGACCATGACCACCTTCACTTGGAACATCAACCACG
CCCGGCTGATGGTGGTGGAGGAACGATGTGTTTACTGTGTGAACTCTGACAATAGCGGCTGGAC
CGAAATCCGTCGGGAGGCCTGGGTCTCCTCTAGCTTATTTGGTGTCTCCAGAGCTGTCCAGGAA
TTTGGTCTTGCCCGGTTCAAAAGCAATGTGACCAAGACAATGAAGGGCTTTGAATACATCCTGG
CCAAGCTACAAGGTGAGGCCCCTTCAAAAACACTTGTTGAGACAGCCAAGGAGGCCAAAGAGAA
AGCAAAGGAGACCGCACTGGCAGCTACAGAGAAGGCCAAGGACCTGGCCAACAAGGCCGCCACC
AAGCAGCAGCAGCAGCAGCTCGTATAGCCCTCTTCCTCTCCCTCCTCCCCCGTGTACTTGATTA
TTAAAGATGAACCTGCAGCCCTCTCTGCTGTCTGGGGTGGTGGGTCAGAGCGCTGTCCTGGTCA
GCATCTGCACCACGTCCAGGTCTATCTGCTGGGCCGGTCGAGGGGTGCAGTGACTTGCCCAAGG
TCACAGCAGTGCAATAGACTGTACGCTCCACGAGGGCAGGACTCCCCGTGTCCTCTGCTGGGTC
CCACGTCCCCTGAACAATATTTAGCACATAACAGGCACTCAATAAACACATGATTTGACTGCCC
CAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009636	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88284	(Get FASTA)	NCBI Sequence Viewer
	EDL94001	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000100636
	ENSRNOP00000100636.1

RefSeq Acc Id:

NP_001009636 ⟸ NM_001009636

- UniProtKB:

Q5M829 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPR
WAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRR
EAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKET
ALAATEKAKDLANKAATKQQQQQLV

hide sequence

Ensembl Acc Id:

ENSRNOP00000070144 ⟸ ENSRNOT00000091320

Ensembl Acc Id:

ENSRNOP00000022134 ⟸ ENSRNOT00000022134

Protein Domains

PRELI/MSF1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M829-F1-model_v2	AlphaFold	Q5M829	1-217	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700312

Promoter ID:

EPDNEW_R10835

Type:

multiple initiation site

Name:

Prelid1_1

Description:

PRELI domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	9,837,303 - 9,837,363	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308082	AgrOrtholog
BioCyc Gene	G2FUF-10196	BioCyc
Ensembl Genes	ENSRNOG00000016410	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022134	ENTREZGENE
	ENSRNOT00000022134.9	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7323653	IMAGE-MGC_LOAD
InterPro	PRELI/MSF1	UniProtKB/TrEMBL
	Slowmo/Ups	UniProtKB/TrEMBL
KEGG Report	rno:290995	UniProtKB/TrEMBL
MGC_CLONE	MGC:109157	IMAGE-MGC_LOAD
NCBI Gene	290995	ENTREZGENE
PANTHER	PTHR11158	UniProtKB/TrEMBL
Pfam	PRELI	UniProtKB/TrEMBL
PhenoGen	Prelid1	PhenoGen
PROSITE	PRELI_MSF1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016410	RatGTEx
RNAcentral	URS00022B28DA	RNACentral
UniProt	A0ABK0LBH0_RAT	UniProtKB/TrEMBL
	Q5M829	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Prelid1	PRELI domain containing 1	RGD1308082	similar to px19-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308082	similar to px19-like protein	RGD1308082_predicted	similar to px19-like protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308082_predicted	similar to px19-like protein (predicted)	LOC290995_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290995_predicted	similar to px19-like protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message