Advanced Search (OLGA)

Gene: Edf1 (endothelial differentiation-related factor 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Edf1

Name:

endothelial differentiation-related factor 1

RGD ID:

1308073

Description:

Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in cell differentiation and positive regulation of DNA-templated transcription. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Orthologous to human EDF1 (endothelial differentiation related factor 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calmodulin-associated peptide 19; calmodulin-associated peptide-19; CAP-19; EDF-1; endothelial differentiation-related factor 1 homolog; MBF1; multiprotein-bridging factor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDF1 (endothelial differentiation related factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Edf1 (endothelial differentiation-related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Edf1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EDF1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EDF1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Edf1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EDF1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EDF1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Edf1 (endothelial differentiation related factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CLTB (clathrin light chain B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EDF1 (endothelial differentiation related factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Edf1 (endothelial differentiation-related factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	edf1 (endothelial differentiation-related factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MBF1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mbf-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mbf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	edf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	28,764,906 - 28,779,499 (+)	NCBI		GRCr8
mRatBN7.2	3	8,377,058 - 8,381,363 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	8,366,613 - 8,381,363 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	11,482,239 - 11,486,544 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,068,465 - 20,072,770 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	18,258,308 - 18,262,613 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	2,781,169 - 2,785,474 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	2,781,169 - 2,785,474 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	2,762,582 - 2,766,887 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	3,727,811 - 3,732,116 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	3,727,749 - 3,732,118 (+)	NCBI
Celera	3	3,202,038 - 3,206,343 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Edf1	Rat	Adams-Oliver Syndrome 5		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Adams-Oliver syndrome 5	ClinVar	PMID:16025100\|PMID:19597493\|PMID:19668216\|PMID:21457232\|PMID:22318994\|PMID:23034536\|PMID:23386033\|PMID:25132448\|PMID:25516202\|PMID:25963545\|PMID:26820064\|PMID:28125082\|PMID:28492532
Edf1	Rat	autosomal dominant intellectual developmental disorder 8		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder with or without hyperkinetic movements and seizures, autosomal more ...	ClinVar	PMID:28492532
Edf1	Rat	autosomal dominant nocturnal frontal lobe epilepsy 5		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Autosomal dominant nocturnal frontal lobe epilepsy 5	ClinVar	PMID:28492532
Edf1	Rat	developmental and epileptic encephalopathy 14		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 14 \| ClinVar Annotator: match by more ...	ClinVar	PMID:19264732\|PMID:27891178\|PMID:28492532
Edf1	Rat	developmental and epileptic encephalopathy 14		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 14 \| ClinVar Annotator: match by more ...	ClinVar	PMID:16025100\|PMID:19264732\|PMID:19597493\|PMID:19668216\|PMID:21457232\|PMID:22318994\|PMID:23034536\|PMID:23386033\|PMID:25132448\|PMID:25516202\|PMID:25963545\|PMID:26820064\|PMID:27891178\|PMID:28125082\|PMID:28492532
Edf1	Rat	Joubert syndrome 1		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:16025100\|PMID:19597493\|PMID:19668216\|PMID:21457232\|PMID:22318994\|PMID:23034536\|PMID:23386033\|PMID:25132448\|PMID:25516202\|PMID:25963545\|PMID:26820064\|PMID:28125082\|PMID:28492532
Edf1	Rat	Kleefstra syndrome 1		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Kleefstra syndrome 1	ClinVar	PMID:19264732\|PMID:22318994\|PMID:22890305\|PMID:25741868\|PMID:27891178\|PMID:28492532\|PMID:31209758
Edf1	Rat	Leigh disease		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:28492532
Edf1	Rat	primary coenzyme Q10 deficiency 7		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:28492532
Edf1	Rat	Rafiq syndrome		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Rafiq syndrome	ClinVar	PMID:24566669\|PMID:28492532\|PMID:30982612
Edf1	Rat	tuberous sclerosis 1		ISO	RGD:1317635	8554872	ClinVar Annotator: match by term: Tuberous sclerosis 1	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Edf1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1317636	6480464	Ethinyl Estradiol results in increased expression of EDF1 mRNA	CTD	PMID:17942748
Edf1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1317636	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EDF1 mRNA	CTD	PMID:17942748
Edf1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1317636	6480464	Estradiol results in decreased expression of EDF1 mRNA	CTD	PMID:39298647
Edf1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1317636	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of EDF1 mRNA	CTD	PMID:30294300
Edf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1317636	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EDF1 mRNA	CTD	PMID:17942748
Edf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of EDF1 mRNA	CTD	PMID:33387578
Edf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of EDF1 mRNA	CTD	PMID:32109520
Edf1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1317636	6480464	Tetrachlorodibenzodioxin affects the expression of EDF1 mRNA	CTD	PMID:21570461
Edf1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1317635	6480464	[Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ...	CTD	PMID:38598786
Edf1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of EDF1 mRNA	CTD	PMID:21346803
Edf1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1317636	6480464	bisphenol S results in increased expression of EDF1 mRNA	CTD	PMID:39298647
Edf1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1317636	6480464	bisphenol S results in decreased methylation of EDF1 exon	CTD	PMID:33297965
Edf1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of EDF1 mRNA	CTD	PMID:30047161
Edf1	Rat	7,12-dimethyltetraphene	increases expression	ISO	RGD:1317636	6480464	9,10-Dimethyl-1,2-benzanthracene results in increased expression of EDF1 protein	CTD	PMID:39910959
Edf1	Rat	afimoxifene	affects response to substance	ISO	RGD:1317635	6480464	EDF1 gene affects the susceptibility to afimoxifene	CTD	PMID:21482774
Edf1	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	RGD:1317635	6480464	aflatoxin B2 results in decreased methylation of EDF1 polyA tail	CTD	PMID:30157460
Edf1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of EDF1 mRNA	CTD	PMID:30047161
Edf1	Rat	antirheumatic drug	decreases expression	ISO	RGD:1317635	6480464	Antirheumatic Agents results in decreased expression of EDF1 mRNA	CTD	PMID:25339124
Edf1	Rat	arsane	affects methylation	ISO	RGD:1317635	6480464	Arsenic affects the methylation of EDF1 gene	CTD	PMID:25304211
Edf1	Rat	arsenic atom	affects methylation	ISO	RGD:1317635	6480464	Arsenic affects the methylation of EDF1 gene	CTD	PMID:25304211
Edf1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1317636	6480464	Benzo(a)pyrene results in decreased expression of EDF1 mRNA	CTD	PMID:20127859
Edf1	Rat	benzo[e]pyrene	decreases methylation	ISO	RGD:1317635	6480464	benzo(e)pyrene results in decreased methylation of EDF1 polyA tail	CTD	PMID:30157460
Edf1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1317636	6480464	Diethylhexyl Phthalate results in increased expression of EDF1 mRNA	CTD	PMID:33754040
Edf1	Rat	bisphenol A	decreases expression	ISO	RGD:1317635	6480464	bisphenol A results in decreased expression of EDF1 mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:25047013\|PMID:37567409
Edf1	Rat	bisphenol A	decreases expression	ISO	RGD:1317636	6480464	bisphenol A results in decreased expression of EDF1 mRNA	CTD	PMID:35598803
Edf1	Rat	bisphenol A	multiple interactions	ISO	RGD:1317635	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of EDF1 gene	CTD	PMID:31601247
Edf1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of EDF1 mRNA	CTD	PMID:33296240
Edf1	Rat	bisphenol A	affects expression	ISO	RGD:1317635	6480464	bisphenol A affects the expression of EDF1 mRNA	CTD	PMID:30903817
Edf1	Rat	bisphenol A	affects methylation	ISO	RGD:1317636	6480464	bisphenol A affects the methylation of EDF1 promoter	CTD	PMID:27334623
Edf1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of EDF1 mRNA	CTD	PMID:25181051\|PMID:31129395\|PMID:32145629
Edf1	Rat	bisphenol F	decreases expression	ISO	RGD:1317636	6480464	bisphenol F results in decreased expression of EDF1 mRNA	CTD	PMID:38685157
Edf1	Rat	Brodifacoum	decreases expression	EXP		6480464	bromfenacoum results in decreased expression of EDF1 protein	CTD	PMID:28903499
Edf1	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of EDF1 promoter	CTD	PMID:22457795
Edf1	Rat	cadmium dichloride	increases expression	ISO	RGD:1317635	6480464	Cadmium Chloride results in increased expression of EDF1 mRNA	CTD	PMID:38568856
Edf1	Rat	clobetasol	increases expression	ISO	RGD:1317636	6480464	Clobetasol results in increased expression of EDF1 mRNA	CTD	PMID:27462272
Edf1	Rat	cobalt dichloride	decreases expression	ISO	RGD:1317635	6480464	cobaltous chloride results in decreased expression of EDF1 mRNA	CTD	PMID:19376846
Edf1	Rat	cyclosporin A	increases expression	ISO	RGD:1317635	6480464	Cyclosporine results in increased expression of EDF1 mRNA	CTD	PMID:20106945
Edf1	Rat	dextran sulfate	increases expression	ISO	RGD:1317636	6480464	Dextran Sulfate results in increased expression of EDF1 mRNA	CTD	PMID:35093514
Edf1	Rat	diazinon	increases methylation	ISO	RGD:1317635	6480464	Diazinon results in increased methylation of EDF1 gene	CTD	PMID:22964155
Edf1	Rat	dibutyl phthalate	decreases expression	ISO	RGD:1317636	6480464	Dibutyl Phthalate results in decreased expression of EDF1 mRNA	CTD	PMID:17361019\|PMID:21266533
Edf1	Rat	doxorubicin	increases expression	ISO	RGD:1317635	6480464	Doxorubicin results in increased expression of EDF1 mRNA	CTD	PMID:29803840
Edf1	Rat	elemental selenium	increases expression	ISO	RGD:1317635	6480464	Selenium results in increased expression of EDF1 mRNA	CTD	PMID:19244175
Edf1	Rat	fenthion	decreases expression	ISO	RGD:1317636	6480464	Fenthion results in decreased expression of EDF1 mRNA	CTD	PMID:34813904
Edf1	Rat	FR900359	decreases phosphorylation	ISO	RGD:1317635	6480464	FR900359 results in decreased phosphorylation of EDF1 protein	CTD	PMID:37730182
Edf1	Rat	fulvestrant	multiple interactions	ISO	RGD:1317635	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of EDF1 gene	CTD	PMID:31601247
Edf1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of EDF1 gene	CTD	PMID:22079235
Edf1	Rat	furfural	multiple interactions	ISO	RGD:1317635	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ...	CTD	PMID:38598786
Edf1	Rat	ivermectin	decreases expression	ISO	RGD:1317635	6480464	Ivermectin results in decreased expression of EDF1 protein	CTD	PMID:32959892
Edf1	Rat	methapyrilene	decreases methylation	ISO	RGD:1317635	6480464	Methapyrilene results in decreased methylation of EDF1 polyA tail	CTD	PMID:30157460
Edf1	Rat	methidathion	decreases expression	ISO	RGD:1317636	6480464	methidathion results in decreased expression of EDF1 mRNA	CTD	PMID:34813904
Edf1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of EDF1 mRNA	CTD	PMID:30047161
Edf1	Rat	N-methyl-N-nitrosourea	decreases expression	ISO	RGD:1317636	6480464	Methylnitrosourea results in decreased expression of EDF1 mRNA	CTD	PMID:25270620
Edf1	Rat	nitrates	multiple interactions	ISO	RGD:1317636	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EDF1 more ...	CTD	PMID:35964746
Edf1	Rat	perfluorooctane-1-sulfonic acid	affects expression	ISO	RGD:1317636	6480464	perfluorooctane sulfonic acid affects the expression of EDF1 mRNA	CTD	PMID:19429403
Edf1	Rat	perfluorooctanoic acid	affects expression	ISO	RGD:1317636	6480464	perfluorooctanoic acid affects the expression of EDF1 mRNA	CTD	PMID:19429403
Edf1	Rat	phenylephrine	affects response to substance	EXP		6480464	MBF1 protein affects the susceptibility to Phenylephrine	CTD	PMID:12729799
Edf1	Rat	phenylephrine	increases expression	EXP		6480464	Phenylephrine results in increased expression of MBF1	CTD	PMID:12729799
Edf1	Rat	phenylephrine	multiple interactions	EXP		6480464	MBF1 protein promotes the reaction [Phenylephrine results in increased expression of NPPA protein]	CTD	PMID:12729799
Edf1	Rat	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of EDF1 mRNA	CTD	PMID:30047161
Edf1	Rat	selenium atom	increases expression	ISO	RGD:1317635	6480464	Selenium results in increased expression of EDF1 mRNA	CTD	PMID:19244175
Edf1	Rat	sodium arsenite	increases expression	ISO	RGD:1317635	6480464	sodium arsenite results in increased expression of EDF1 mRNA	CTD	PMID:38568856
Edf1	Rat	sodium chloride	multiple interactions	ISO	RGD:1317635	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ...	CTD	PMID:38598786
Edf1	Rat	staurosporine	multiple interactions	EXP		6480464	Staurosporine inhibits the reaction [MBF1 protein results in increased secretion of NPPA protein]	CTD	PMID:12729799
Edf1	Rat	staurosporine	decreases expression	EXP		6480464	Staurosporine results in decreased expression of MBF1 protein	CTD	PMID:12729799
Edf1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of EDF1 mRNA	CTD	PMID:30047161
Edf1	Rat	tetrachloroethene	decreases expression	ISO	RGD:1317636	6480464	Tetrachloroethylene results in decreased expression of EDF1 mRNA	CTD	PMID:28973375
Edf1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of EDF1 mRNA	CTD	PMID:31150632
Edf1	Rat	vitamin E	increases expression	ISO	RGD:1317635	6480464	Vitamin E results in increased expression of EDF1 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Edf1	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Edf1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	GO:0003713	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Edf1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Edf1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Edf1	Rat	cytoplasm	located_in	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	cytoplasm	located_in	ISO	RGD:1317635\|UniProtKB:O60869-1	1624291	PMID:10567391	RGD	PMID:10567391
Edf1	Rat	cytosol	located_in	ISO	RGD:1317635\|UniProtKB:O60869-1\|UniProtKB:O60869-2\|UniProtKB:O60869-3	1624291		RGD	GO_REF:0000052
Edf1	Rat	cytosol	located_in	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	nucleolus	located_in	ISO	RGD:1317635\|UniProtKB:O60869-1\|UniProtKB:O60869-2\|UniProtKB:O60869-3	1624291		RGD	GO_REF:0000052
Edf1	Rat	nucleolus	located_in	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	nucleoplasm	located_in	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	nucleoplasm	located_in	ISO	RGD:1317635\|UniProtKB:O60869-1\|UniProtKB:O60869-2\|UniProtKB:O60869-3	1624291		RGD	GO_REF:0000052
Edf1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Edf1	Rat	nucleus	located_in	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	nucleus	is_active_in	IBA	FB:FBgn0262732\|PANTHER:PTN000028491\|TAIR:locus:2041509\|TAIR:locus:2091747\|TAIR:locus:2098994\|UniProtKB:O60869\|UniProtKB:Q8II81	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Edf1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Edf1	Rat	nucleus	located_in	ISO	RGD:1317635\|UniProtKB:O60869-1	1624291	PMID:10567391	RGD	PMID:10567391

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Edf1	Rat	calmodulin binding	enables	IEA	UniProtKB-KW:KW-0112	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Edf1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Edf1	Rat	DNA binding	enables	IEA	InterPro:IPR010982	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Edf1	Rat	protein binding	enables	ISO	RGD:1317635\|UniProtKB:O60869-1	1624291	UniProtKB:Q04752 PMID:10567391	RGD	PMID:10567391
Edf1	Rat	protein binding	enables	ISO	RGD:1317635	1624291	UniProtKB:O00482\|UniProtKB:P03372\|UniProtKB:P03495\|UniProtKB:P13569\|UniProtKB:P19793\|UniProtKB:P20226\|UniProtKB:P37231\|UniProtKB:P42858\|UniProtKB:P50222\|UniProtKB:Q13133\|UniProtKB:Q13285 PMID:10567391, PMID:12040021, PMID:21217774, PMID:24008843, PMID:25416956, PMID:31527615, PMID:32814053, PMID:35156780, PMID:36012204	RGD	PMID:10567391\|PMID:12040021\|PMID:21217774\|PMID:24008843\|PMID:25416956\|PMID:31527615\|PMID:32814053\|PMID:35156780\|PMID:36012204
Edf1	Rat	protein binding	enables	ISO	RGD:1317635,UniProtKB:O60869-1	1624291	UniProtKB:P20226 PMID:10567391	RGD	PMID:10567391
Edf1	Rat	TFIID-class transcription factor complex binding	enables	ISO	RGD:1317635	1624291	PMID:12040021	RGD	PMID:12040021
Edf1	Rat	TFIID-class transcription factor complex binding	enables	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Edf1	Rat	transcription coactivator activity	enables	ISO	RGD:1317635	1624291	PMID:10567391, PMID:12040021	RGD	PMID:10567391\|PMID:12040021
Edf1	Rat	transcription coactivator activity	enables	IEA	UniProtKB:O60869\|ensembl:ENSP00000224073	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9795107	PMID:10567391	PMID:12040021	PMID:12477932	PMID:12729799	PMID:15489334	PMID:16854843	PMID:22658674	PMID:22681889	PMID:23376485

Edf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	28,764,906 - 28,779,499 (+)	NCBI		GRCr8
mRatBN7.2	3	8,377,058 - 8,381,363 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	8,366,613 - 8,381,363 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	11,482,239 - 11,486,544 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,068,465 - 20,072,770 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	18,258,308 - 18,262,613 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	2,781,169 - 2,785,474 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	2,781,169 - 2,785,474 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	2,762,582 - 2,766,887 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	3,727,811 - 3,732,116 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	3,727,749 - 3,732,118 (+)	NCBI
Celera	3	3,202,038 - 3,206,343 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

EDF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	136,862,119 - 136,866,308 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	136,862,119 - 136,866,308 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	139,756,571 - 139,760,760 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	138,876,392 - 138,880,559 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	137,033,069 - 137,036,575	NCBI
Celera	9	110,270,359 - 110,274,526 (-)	NCBI		Celera
Cytogenetic Map	9	q34.3	NCBI
HuRef	9	109,215,783 - 109,220,005 (-)	NCBI		HuRef
CHM1_1	9	139,905,298 - 139,909,520 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	149,096,300 - 149,100,489 (-)	NCBI		T2T-CHM13v2.0

Edf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	25,447,838 - 25,452,096 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	25,447,859 - 25,452,094 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	25,557,824 - 25,562,084 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	25,557,847 - 25,562,082 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	25,413,420 - 25,417,602 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	25,379,909 - 25,384,087 (+)	NCBI		MGSCv36	mm8
Celera	2	25,285,667 - 25,289,849 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	17.39	NCBI

Edf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	4,942,268 - 4,946,000 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	4,942,268 - 4,945,645 (-)	NCBI	ChiLan1.0	ChiLan1.0

EDF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	2,535,939 - 2,540,242 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	2,538,330 - 2,542,577 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	107,919,200 - 107,923,415 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	136,889,383 - 136,892,852 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	136,889,383 - 136,891,133 (-)	Ensembl	panpan1.1		panPan2

EDF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	48,722,918 - 48,726,358 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	48,722,658 - 48,731,723 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	47,936,663 - 47,940,071 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	49,601,089 - 49,604,497 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	49,600,836 - 49,604,400 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	48,377,308 - 48,380,716 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	48,676,021 - 48,679,429 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	48,722,977 - 48,726,385 (+)	NCBI		UU_Cfam_GSD_1.0

Edf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	202,319,890 - 202,323,896 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936669	1,051,137 - 1,055,168 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936669	1,051,137 - 1,055,168 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EDF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	1	313,804,978 - 313,808,689 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EDF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	1,322,424 - 1,327,241 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	1,322,311 - 1,329,789 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	3,949,568 - 3,954,851 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Edf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	986,822 - 990,019 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	986,820 - 990,019 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Edf1
6 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	46
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000022196
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

RH125844

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	16	51,399,293 - 51,399,541	NCBI	Rnor5.0
RGSC_v3.4	16	51,962,979 - 51,963,226	UniSTS	RGSC3.4
Celera	18	66,208,131 - 66,208,481	UniSTS
Celera	16	46,468,014 - 46,468,261	UniSTS
Cytogenetic Map	3	p13	UniSTS
Cytogenetic Map	16	q12.1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158849	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022196 ⟹ ENSRNOP00000022196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	8,366,613 - 8,381,363 (+)	Ensembl
Rnor_6.0 Ensembl	3	2,781,169 - 2,785,474 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104551 ⟹ ENSRNOP00000091633

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	8,377,477 - 8,381,363 (+)	Ensembl

RefSeq Acc Id:

NM_001106557 ⟹ NP_001100027

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	28,775,194 - 28,779,499 (+)	NCBI
mRatBN7.2	3	8,377,058 - 8,381,363 (+)	NCBI
Rnor_6.0	3	2,781,169 - 2,785,474 (+)	NCBI
Rnor_5.0	3	2,762,582 - 2,766,887 (+)	NCBI
RGSC_v3.4	3	3,727,811 - 3,732,116 (+)	RGD
Celera	3	3,202,038 - 3,206,343 (+)	RGD

Sequence:

show sequence

TCGCGTCGCCGCGCCGGGTCTCGAGCAGCTGCCAGAGCCGCCGGACAGACCGCCGCCCCCGCCGCGTCATGGCCGAGAGTGACTGGGACACCGTGACGGTGCTGCGCAAGAAGGGCCCCACGGCCGCA
CAGGCCAAGTCTAAGCAGGCCATCTTAGCAGCTCAGCGACGAGGAGAAGATGTGGAGACATCCAAAAAATGGGCTGCTGGCCAGAACAAGCAGCATTCCATCACTAAAAACACAGCCAAGCTAGACCG
GGAGACAGAGGAGCTGCACCACGACAGGGTGACCCTGGAGGTGGGCAAAGTGATCCAGCGGGGCCGGCAGAGCAAAGGCCTGACGCAGAAGGACCTGGCCACGAAAATCAATGAAAAGCCGCAAGTCA
TCGCAGACTATGAAAGTGGACGGGCCATTCCGAATAACCAGGTTTTGGGCAAAATTGAGAGAGCCATCGGCCTCAAGCTCCGGGGGAAGGACATCGGGAAGCCTATCGAGAAGGGGCCGAAGGCGAAA
TGAACACAAAGCCTCGAAGCCAGTGGTTCCGGCTGAGCTCTTCTGGCTGGTCCCCCAGGACCACCAGCACTGCCGTGGGTCTCCTCACATGGTCAAACGGAACATGGGGGTCAGGCCTGTGTGCCCCC
TCAACCCATAACTGCTGTCAAACAAAGCAAAACCTTGGAAAGTGA

hide sequence

RefSeq Acc Id:

XM_063283463 ⟹ XP_063139533

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	28,764,906 - 28,779,499 (+)	NCBI


Protein RefSeqs	NP_001100027	(Get FASTA)	NCBI Sequence Viewer
	XP_063139533	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58850	(Get FASTA)	NCBI Sequence Viewer
	EDL93566	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000100040
GenBank Protein	P69736	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001100027 ⟸ NM_001106557
- UniProtKB:	P69736 (UniProtKB/Swiss-Prot), B0BNJ5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAI GLKLRGKDIGKPIEKGPKAK hide sequence

Ensembl Acc Id:

ENSRNOP00000022196 ⟸ ENSRNOT00000022196

Ensembl Acc Id:

ENSRNOP00000091633 ⟸ ENSRNOT00000104551

RefSeq Acc Id:	XP_063139533 ⟸ XM_063283463
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QBB2 (UniProtKB/TrEMBL)

Protein Domains

HTH cro/C1-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P69736-F1-model_v2	AlphaFold	P69736	1-148	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691883

Promoter ID:

EPDNEW_R2407

Type:

initiation region

Name:

Edf1_1

Description:

endothelial differentiation-related factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	2,781,168 - 2,781,228	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50441	BioCyc
Ensembl Genes	ENSRNOG00000016272	Ensembl
	ENSRNOG00000084601	ENTREZGENE
Ensembl Transcript	ENSRNOT00000132385	ENTREZGENE
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7445841	IMAGE-MGC_LOAD
InterPro	Cro/C1-type_HTH	UniProtKB/Swiss-Prot
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot
	MBF1_N	UniProtKB/Swiss-Prot
KEGG Report	rno:296570	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188333	IMAGE-MGC_LOAD
NCBI Gene	296570	ENTREZGENE
PANTHER	ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1	UniProtKB/Swiss-Prot
	ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1 MULTIPROTEIN BRIDGING FACTOR 1	UniProtKB/Swiss-Prot
Pfam	HTH_3	UniProtKB/Swiss-Prot
	MBF1	UniProtKB/Swiss-Prot
PhenoGen	Edf1	PhenoGen
PROSITE	HTH_CROC1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016272	RatGTEx
	ENSRNOG00000084601	RatGTEx
SMART	HTH_XRE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47413	UniProtKB/Swiss-Prot
UniProt	A0A8I6AEU8_RAT	UniProtKB/TrEMBL
	A0A8L2QBB2	ENTREZGENE, UniProtKB/TrEMBL
	B0BNJ5	ENTREZGENE, UniProtKB/TrEMBL
	EDF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Edf1	endothelial differentiation-related factor 1	Edf1_predicted	endothelial differentiation-related factor 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Edf1_predicted	endothelial differentiation-related factor 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar