Advanced Search (OLGA)

Gene: Pgm5 (phosphoglucomutase 5) Rattus norvegicus

Analyze

Symbol:

Pgm5

Name:

phosphoglucomutase 5

RGD ID:

1307969

Description:

Predicted to enable magnesium ion binding activity. Predicted to be involved in carbohydrate metabolic process; myofibril assembly; and striated muscle tissue development. Predicted to be located in several cellular components, including focal adhesion; myofibril; and spot adherens junction. Predicted to be part of dystrophin-associated glycoprotein complex. Predicted to be active in several cellular components, including adherens junction; cell-substrate junction; and sarcolemma. Orthologous to human PGM5 (phosphoglucomutase 5); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC293975; LOC679990; Pgm5_predicted; phosphoglucomutase 5 (predicted); phosphoglucomutase-like protein 5; similar to phosphoglucomutase 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGM5 (phosphoglucomutase 5)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pgm5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgm5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGM5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGM5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pgm5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGM5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGM5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgm5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pgm5 (phosphoglucomutase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BPTF (bromodomain PHD finger transcription factor)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pgm5 (phosphoglucomutase 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PGM5 (phosphoglucomutase 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pgm5 (phosphoglucomutase 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	R05F9.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PGM1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PGM2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pgm1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgm5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgm5	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	231,752,052 - 231,939,812 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	231,752,052 - 231,939,812 (-)	Ensembl				GRCr8
mRatBN7.2	1	222,325,638 - 222,513,434 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	222,325,643 - 222,513,437 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	230,778,402 - 230,966,148 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	237,708,453 - 237,896,222 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	230,526,461 - 230,714,227 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	242,582,591 - 242,765,837 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	242,582,642 - 242,765,807 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	249,856,475 - 250,039,462 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	228,107,411 - 228,300,939 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	219,534,446 - 219,717,953 (-)	NCBI		Celera
Cytogenetic Map	1	q51	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

juvenile rheumatoid arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

8-Br-cAMP (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

choline (ISO)

cytarabine (ISO)

diallyl disulfide (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethylparaben (ISO)

folic acid (ISO)

FR900359 (ISO)

genistein (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

MeIQx (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

N,N-diethyl-m-toluamide (EXP)

nickel atom (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (EXP)

permethrin (EXP)

phenobarbital (ISO)

pioglitazone (ISO)

Ptaquiloside (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulforaphane (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

XL147 (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

carbohydrate metabolic process (IBA,IEA)

cell adhesion (IEA)

myofibril assembly (IBA)

striated muscle tissue development (IBA)

Cellular Component

adherens junction (IBA,IEA,ISO)

cell-substrate junction (IBA,IEA,ISO)

costamere (IEA,ISO)

cytoplasm (IEA)

cytoplasmic side of plasma membrane (IEA,ISO)

cytoskeleton (IEA)

cytosol (IBA)

dystrophin-associated glycoprotein complex (IEA,ISO)

focal adhesion (IEA,ISO)

intercalated disc (IEA,ISO)

sarcolemma (IBA,IEA,ISO)

spot adherens junction (IEA,ISO)

stress fiber (IEA,ISO)

Z disc (IEA,ISO)

Molecular Function

intramolecular phosphotransferase activity (IEA)

magnesium ion binding (IEA)

metal ion binding (IEA)

phosphoglucomutase activity (IBA,IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:7890770	PMID:8175905	PMID:8631316	PMID:10867799

Genomics

Comparative Map Data

Pgm5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	231,752,052 - 231,939,812 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	231,752,052 - 231,939,812 (-)	Ensembl				GRCr8
mRatBN7.2	1	222,325,638 - 222,513,434 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	222,325,643 - 222,513,437 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	230,778,402 - 230,966,148 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	237,708,453 - 237,896,222 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	230,526,461 - 230,714,227 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	242,582,591 - 242,765,837 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	242,582,642 - 242,765,807 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	249,856,475 - 250,039,462 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	228,107,411 - 228,300,939 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	219,534,446 - 219,717,953 (-)	NCBI		Celera
Cytogenetic Map	1	q51	NCBI

PGM5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	68,356,611 - 68,531,061 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	68,328,308 - 68,535,009 (+)	Ensembl			hg38	GRCh38
GRCh37	9	70,971,527 - 71,145,977 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	70,161,635 - 70,335,797 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	68,201,368 - 68,374,205	NCBI
Celera	9	41,649,833 - 41,741,061 (+)	NCBI		Celera
Celera	9	58,816 - 59,272 (+)	NCBI		Celera
Cytogenetic Map	9	q21.11	NCBI
HuRef	9	40,838,577 - 40,991,637 (+)	NCBI		HuRef
HuRef	9	40,808,181 - 40,827,822 (+)	NCBI		HuRef
CHM1_1	9	71,118,665 - 71,292,979 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	80,530,217 - 80,704,652 (+)	NCBI		T2T-CHM13v2.0

Pgm5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	24,655,625 - 24,839,206 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	24,660,380 - 24,839,219 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	24,678,261 - 24,861,842 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	24,683,016 - 24,861,855 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	24,752,751 - 24,936,332 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	24,745,358 - 24,928,939 (-)	NCBI		MGSCv36	mm8
Celera	19	25,445,492 - 25,631,055 (-)	NCBI		Celera
Cytogenetic Map	19	B	NCBI
cM Map	19	19.78	NCBI

Pgm5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	4,489,054 - 4,670,161 (-)	Ensembl
ChiLan1.0	NW_004955434	4,489,054 - 4,670,879 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGM5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	67,560,634 - 67,739,039 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	67,566,574 - 67,748,940 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	56,262,870 - 56,412,833 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	67,208,334 - 67,293,102 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

PGM5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	88,823,883 - 89,011,091 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	88,825,152 - 88,994,750 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	89,294,433 - 89,483,825 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	89,373,601 - 89,562,986 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	89,373,604 - 89,562,971 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	89,018,887 - 89,209,295 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	88,731,638 - 88,921,371 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	89,491,326 - 89,682,004 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pgm5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	136,312,786 - 136,476,727 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936503	4,696,467 - 4,858,561 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936503	4,696,473 - 4,858,561 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGM5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	221,634,524 - 221,836,459 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	221,634,516 - 221,837,764 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	247,961,314 - 248,143,149 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGM5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	79,447,917 - 79,627,895 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	79,448,227 - 79,629,813 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	67,847,124 - 68,033,584 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgm5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	4,599,809 - 4,804,985 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624736	4,599,808 - 4,804,709 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pgm5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	24,814,901 - 24,988,742 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pgm5
1722 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	65
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000020763
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	243666627	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
5508828	Leukc3	Leukocyte quantity QTL 3			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	1	227535119	233480676	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	223964326	248681945	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	193964073	238964073	Rat
8693661	Alc34	Alcohol consumption QTL 34	2.2	0.611	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	238041033	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	194575422	239575422	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	193400541	238400541	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	205674651	250674651	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	221820316	234540296	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	192995199	237995199	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	203675682	248675682	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	205674651	250674651	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	197807365	233480676	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	193400541	238400541	Rat
634340	Hcar5	Hepatocarcinoma resistance QTL 5	8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	223964326	236074012	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
8693618	Alc25	Alcohol consumption QTL 25	3	0.28	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	238041033	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

D1Got223

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	231,862,385 - 231,862,530 (+)	Marker Load Pipeline
mRatBN7.2	1	222,435,979 - 222,436,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	242,689,697 - 242,689,841	NCBI	Rnor6.0
Rnor_5.0	1	249,963,322 - 249,963,466	UniSTS	Rnor5.0
RGSC_v3.4	1	228,223,065 - 228,223,210	RGD	RGSC3.4
RGSC_v3.4	1	228,223,066 - 228,223,210	UniSTS	RGSC3.4
Celera	1	219,640,880 - 219,641,024	UniSTS
RGSC_v3.1	1	228,387,089 - 228,387,233	RGD
RH 3.4 Map	1	1615.61	RGD
RH 3.4 Map	1	1615.61	UniSTS
RH 2.0 Map	1	1356.7999	RGD
Cytogenetic Map	1	q51	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	56	59	6	320	156	11	132	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020763 ⟹ ENSRNOP00000020763

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	231,752,052 - 231,939,812 (-)	Ensembl
mRatBN7.2 Ensembl	1	222,325,643 - 222,513,437 (-)	Ensembl
Rnor_6.0 Ensembl	1	242,582,642 - 242,765,807 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112231 ⟹ ENSRNOP00000092363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	231,752,052 - 231,939,812 (-)	Ensembl
mRatBN7.2 Ensembl	1	222,325,643 - 222,513,437 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000159566 ⟹ ENSRNOP00000106233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	231,769,176 - 231,939,812 (-)	Ensembl

RefSeq Acc Id:

NM_001191953 ⟹ NP_001178882

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	231,752,052 - 231,939,812 (-)	NCBI
mRatBN7.2	1	222,325,638 - 222,513,434 (-)	NCBI
Rnor_6.0	1	242,582,591 - 242,765,837 (-)	NCBI
Rnor_5.0	1	249,856,475 - 250,039,462 (-)	NCBI
Celera	1	219,534,446 - 219,717,953 (-)	NCBI

Sequence:

show sequence

GCAGCCACGGCAGGACCGGCCAGCGGCGCCATGGAGGGGAGCCCCATCCCGGTGCTGACCGTGC
CCACAGCGCCCTATGAGGACCAGCGGCCGACCGGTGGCGGCGGGCTGCGGCGGCCCACAGGACT
CTTTGAGGGCCAGCGCAACTACCTGCCCAACTTCATCCAGAGTGTGCTGTCGTCCATTGACCTG
CGCGACAGGCAGGGTTGCACGATGGTGGTGGGTAGCGATGGCAGGTACTTCAGCAGGACGGCCA
CTGAGATCGTGGTGCAGATGGCTGCGGCCAACGGGATTGGTCGGCTGATTATTGGGCAGAATGG
CATCTTGTCGACACCTGCAGTCTCCTGCATTATCAGGAAGATCAAAGCAGCTGGTGGGATCATC
CTAACAGCCAGCCACTGTCCTGGAGGACCAGGGGGAGAGTTTGGAGTGAAGTTTAATGTTGCTA
ATGGAGGTCCTGCACCAGATGTCGTCTCAGACAAAATCTACCAGATCAGCAAAACAATTGAGGA
ATATACCATATGCCCCGACCTTCGAATTGACCTATCCCGGCTAGGAAGACAAGAATTTGACCTG
GAGAACAAGTTCAAACCATTCAGAGTGGAGATTGTGGACCCCGTTGACATCTATCTCAACCTCC
TGCGGACTATCTTTGACTTTAACGCCATCAAGAGTTTGCTGACAGGACCCAGCCAGCTGAAGAT
CCGTGTTGATGCTATGCATGGAGTTATGGGGCCCTATGTAAGAAAAGTTCTGTGTGATGAACTG
GGAGCTCCGGCCAACTCCGCCATAAACTGTGTCCCATTAGAAGACTTCGGAGGGCAGCACCCGG
ACCCAAACCTGACATACGCGACCACCCTTCTGGAAGCCATGAAGGGGGGAGAATATGGATTTGG
AGCTGCATTTGATGCTGATGGGGACCGTTATATGATCCTTGGCCAAAATGGCTTCTTTGTGAGT
CCCTCAGACTCCCTCGCCATCATTGCTGCCAACCTCTCTTGCATTCCTTATTTCCGTCAGATGG
GTGTTCGCGGGTTTGGGAGGAGTATGCCAACCAGCATGGCCCTGGACAGAGTGGCTAAATCAAT
GAAGGTTCCTGTGTATGAGACCCCTGCTGGATGGAGATTCTTCTCAAATCTGATGGACTCCGGA
CGATGCTCTCTGTGTGGAGAGGAGAGCTTCGGCACTGGGTCTGATCACCTCCGGGAGAAAGATG
GCCTCTGGGCTGTCTTGGTCTGGCTGTCCATTATTGCTGCCCGGAAACAGAGCGTGGAGGAAAT
TGTTAGAGATCATTGGGCCAAATATGGCCGCCACTACTACTGCAGGTTTGACTACGAGGGACTG
GAGCCTAAGGCTACGTATTACATCATGAGGGACCTGGAGGCCCTGGTTACGGACAAGTCCTTCA
TCGGCCAGCAGTTTGCTGTGGGGAGCCACATTTACAGCATTGCAAAGACCGACAGCTTTGAGTA
TGTGGACCCTGTGGATGGCACCGTGACCAAGAAACAGGGCCTGAGGATCATCTTTTCGGATGCA
TCACGGCTTATATTCCGGCTCAGTTCCTCCAGTGGTGTTCGGGCCACCATCAGACTGTATGCGG
AGAGCTACGAGAGGGATCCCAGCGGTCACGATCAGGAACCACAGGCAGTGCTGAGCCCTCTCAT
AGCCATTGCGCTGAAAATATCCCAGATTCATGAGAGAACTGGCCGGAGAGGACCCACCGTCATC
ACCTAAGCACAGGGCGGCAGAGCACTGGGAGAGATGCTTCACCATGCCTTCTCGCTT

hide sequence

RefSeq Acc Id:

XM_063273533 ⟹ XP_063129603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	231,752,055 - 231,937,464 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178882	(Get FASTA)	NCBI Sequence Viewer
	XP_063129603	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZVR9	(Get FASTA)	NCBI Sequence Viewer
	EDM13040	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020763.6
	ENSRNOP00000092363

RefSeq Acc Id:

NP_001178882 ⟸ NM_001191953

- UniProtKB:

D3ZVR9 (UniProtKB/Swiss-Prot), A0A8I6AHF8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGSPIPVLTVPTAPYEDQRPTGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVV
GSDGRYFSRTATEIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGP
GGEFGVKFNVANGGPAPDVVSDKIYQISKTIEEYTICPDLRIDLSRLGRQEFDLENKFKPFRVE
IVDPVDIYLNLLRTIFDFNAIKSLLTGPSQLKIRVDAMHGVMGPYVRKVLCDELGAPANSAINC
VPLEDFGGQHPDPNLTYATTLLEAMKGGEYGFGAAFDADGDRYMILGQNGFFVSPSDSLAIIAA
NLSCIPYFRQMGVRGFGRSMPTSMALDRVAKSMKVPVYETPAGWRFFSNLMDSGRCSLCGEESF
GTGSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRDHWAKYGRHYYCRFDYEGLEPKATYYIMR
DLEALVTDKSFIGQQFAVGSHIYSIAKTDSFEYVDPVDGTVTKKQGLRIIFSDASRLIFRLSSS
SGVRATIRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGRRGPTVIT

hide sequence

Ensembl Acc Id:

ENSRNOP00000020763 ⟸ ENSRNOT00000020763

Ensembl Acc Id:

ENSRNOP00000092363 ⟸ ENSRNOT00000112231

RefSeq Acc Id:	XP_063129603 ⟸ XM_063273533
- Peptide Label:	isoform X1
- UniProtKB:	A6I0Q9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000106233 ⟸ ENSRNOT00000159566

Protein Domains

Alpha-D-phosphohexomutase alpha/beta/alpha

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZVR9-F1-model_v2	AlphaFold	D3ZVR9	1-567	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690828

Promoter ID:

EPDNEW_R1353

Type:

initiation region

Name:

Pgm5_1

Description:

phosphoglucomutase 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	242,765,854 - 242,765,914	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307969	AgrOrtholog
BioCyc Gene	G2FUF-56088	BioCyc
Ensembl Genes	ENSRNOG00000015406	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020763.8	UniProtKB/Swiss-Prot
	ENSRNOT00000112231	ENTREZGENE
Gene3D-CATH	Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3	UniProtKB/Swiss-Prot
	Alpha-D-phosphohexomutase, C-terminal domain	UniProtKB/Swiss-Prot
InterPro	A-D-PHexomutase_a/b/a-I	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-I/II/III	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-II	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-III	UniProtKB/Swiss-Prot
	A-D-PHexomutase_C_sf	UniProtKB/Swiss-Prot
	A-D-PHexomutase_CS	UniProtKB/Swiss-Prot
	Alpha-D-phosphohexomutase_SF	UniProtKB/Swiss-Prot
	PGM	UniProtKB/Swiss-Prot
NCBI Gene	Pgm5	ENTREZGENE
PANTHER	PHOSPHOGLUCOMUTASE-LIKE PROTEIN 5	UniProtKB/Swiss-Prot
	PTHR22573	UniProtKB/Swiss-Prot
Pfam	PGM1_C_vert_fung	UniProtKB/Swiss-Prot
	PGM_PMM_I	UniProtKB/Swiss-Prot
	PGM_PMM_II	UniProtKB/Swiss-Prot
	PGM_PMM_III	UniProtKB/Swiss-Prot
PhenoGen	Pgm5	PhenoGen
PRINTS	PGMPMM	UniProtKB/Swiss-Prot
PROSITE	PGM_PMM	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015406	RatGTEx
Superfamily-SCOP	SSF53738	UniProtKB/Swiss-Prot
	SSF55957	UniProtKB/Swiss-Prot
UniProt	A0A8I6AHF8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LWV6_RAT	UniProtKB/TrEMBL
	A6I0Q9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZVR9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-07-08	Pgm5	phosphoglucomutase 5	LOC687552	similar to phosphoglucomutase 5	Data merged from RGD:1584213	1643240	APPROVED
2008-04-30	Pgm5	phosphoglucomutase 5	Pgm5_predicted	phosphoglucomutase 5 (predicted)	'predicted' is removed	2292626	APPROVED
2007-10-17	Pgm5_predicted	phosphoglucomutase 5 (predicted)	LOC679990	similar to phosphoglucomutase 5	Data merged from RGD:1598080	737654	PROVISIONAL
2006-11-20	LOC679990	similar to phosphoglucomutase 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687552	similar to phosphoglucomutase 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Pgm5_predicted	phosphoglucomutase 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD