Advanced Search (OLGA)

Gene: Nedd1 (NEDD1 gamma-tubulin ring complex targeting factor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Nedd1

Name:

NEDD1 gamma-tubulin ring complex targeting factor

RGD ID:

1307750

Description:

Predicted to enable gamma-tubulin binding activity. Predicted to be involved in microtubule nucleation and mitotic cell cycle. Predicted to be located in several cellular components, including apical part of cell; nuclear lumen; and pericentriolar material. Predicted to be active in cytoplasm and microtubule cytoskeleton. Orthologous to human NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor); INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC299730; neural precursor cell expressed, developmentally down-regulated 1; neural precursor cell expressed, developmentally down-regulated gene 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	29,120,200 - 29,161,634 (-)	NCBI		GRCr8
mRatBN7.2	7	27,233,050 - 27,274,486 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	27,233,316 - 27,274,486 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	29,227,389 - 29,268,826 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	31,389,742 - 31,431,181 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	31,157,130 - 31,202,370 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	33,544,097 - 33,584,406 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	33,543,828 - 33,584,564 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	33,615,235 - 33,655,544 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	29,704,249 - 29,745,416 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	29,724,518 - 29,773,468 (-)	NCBI
Celera	7	24,340,948 - 24,381,914 (-)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nedd1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NEDD1 mRNA	CTD	PMID:22079256
Nedd1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of NEDD1 mRNA]	CTD	PMID:22206623
Nedd1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Nedd1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of NEDD1 mRNA	CTD	PMID:22206623
Nedd1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Nedd1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of NEDD1 mRNA	CTD	PMID:17555576
Nedd1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NEDD1 mRNA	CTD	PMID:17942748
Nedd1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Nedd1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of NEDD1 mRNA	CTD	PMID:17942748
Nedd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NEDD1 mRNA	CTD	PMID:17942748
Nedd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Nedd1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of NEDD1 mRNA	CTD	PMID:21570461
Nedd1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of NEDD1 mRNA	CTD	PMID:21346803
Nedd1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Nedd1 (Mus musculus)	6480464	bisphenol S results in decreased expression of NEDD1 mRNA	CTD	PMID:39298647
Nedd1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of NEDD1 mRNA	CTD	PMID:24780913 and PMID:30047161
Nedd1	Rat	acrolein	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NEDD1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of NEDD1 mRNA	CTD	PMID:32699268
Nedd1	Rat	aflatoxin B1	affects expression	ISO	NEDD1 (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of NEDD1 protein	CTD	PMID:20106945
Nedd1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of NEDD1 mRNA	CTD	PMID:23630614
Nedd1	Rat	aflatoxin M1	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Aflatoxin M1 results in decreased expression of NEDD1 mRNA	CTD	PMID:30928695
Nedd1	Rat	all-trans-retinoic acid	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of NEDD1 mRNA	CTD	PMID:33167477
Nedd1	Rat	alpha-pinene	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NEDD1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of NEDD1 mRNA	CTD	PMID:32699268
Nedd1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of NEDD1 mRNA	CTD	PMID:30047161
Nedd1	Rat	aristolochic acid A	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of NEDD1 mRNA	CTD	PMID:33212167
Nedd1	Rat	Aroclor 1254	decreases expression	ISO	Nedd1 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of NEDD1 mRNA	CTD	PMID:23650126
Nedd1	Rat	arsenous acid	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of NEDD1 mRNA	CTD	PMID:20458559
Nedd1	Rat	benzo[a]pyrene	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of NEDD1 mRNA	CTD	PMID:21632981
Nedd1	Rat	benzo[a]pyrene	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of NEDD1 mRNA	CTD	PMID:32234424
Nedd1	Rat	benzo[a]pyrene	affects methylation	ISO	NEDD1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NEDD1 promoter	CTD	PMID:27901495
Nedd1	Rat	beta-lapachone	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	beta-lapachone results in increased expression of NEDD1 mRNA	CTD	PMID:38218311
Nedd1	Rat	beta-lapachone	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of NEDD1 mRNA	CTD	PMID:38218311
Nedd1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NEDD1 mRNA	CTD	PMID:25181051
Nedd1	Rat	bisphenol A	decreases expression	ISO	Nedd1 (Mus musculus)	6480464	bisphenol A results in decreased expression of NEDD1 mRNA	CTD	PMID:37894381
Nedd1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NEDD1 mRNA	CTD	PMID:30816183
Nedd1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of NEDD1 gene	CTD	PMID:28505145
Nedd1	Rat	bortezomib	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Bortezomib results in increased expression of NEDD1 mRNA	CTD	PMID:20977926
Nedd1	Rat	cadmium dichloride	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of NEDD1 mRNA	CTD	PMID:38568856
Nedd1	Rat	caffeine	affects phosphorylation	ISO	NEDD1 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of NEDD1 protein	CTD	PMID:35688186
Nedd1	Rat	carbamazepine	affects expression	ISO	NEDD1 (Homo sapiens)	6480464	Carbamazepine affects the expression of NEDD1 mRNA	CTD	PMID:25979313
Nedd1	Rat	choline	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NEDD1 gene	CTD	PMID:20938992
Nedd1	Rat	copper(II) sulfate	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of NEDD1 mRNA	CTD	PMID:19549813
Nedd1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of NEDD1 mRNA	CTD	PMID:26577399
Nedd1	Rat	cyclosporin A	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of NEDD1 mRNA	CTD	PMID:20106945
Nedd1	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of NEDD1 mRNA	CTD	PMID:23914054
Nedd1	Rat	diarsenic trioxide	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of NEDD1 mRNA	CTD	PMID:20458559
Nedd1	Rat	dicrotophos	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of NEDD1 mRNA	CTD	PMID:28302478
Nedd1	Rat	doxorubicin	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of NEDD1 mRNA	CTD	PMID:29803840
Nedd1	Rat	ethyl methanesulfonate	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of NEDD1 mRNA	CTD	PMID:23649840
Nedd1	Rat	folic acid	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NEDD1 gene more ...	CTD	PMID:20938992 and PMID:22206623
Nedd1	Rat	formaldehyde	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Formaldehyde results in increased expression of NEDD1 mRNA	CTD	PMID:23649840
Nedd1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of NEDD1 mRNA	CTD	PMID:33387578
Nedd1	Rat	hydralazine	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of NEDD1 mRNA	CTD	PMID:17183730
Nedd1	Rat	L-methionine	multiple interactions	ISO	Nedd1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NEDD1 gene	CTD	PMID:20938992
Nedd1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of NEDD1 mRNA	CTD	PMID:30047161
Nedd1	Rat	methyl methanesulfonate	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of NEDD1 mRNA	CTD	PMID:23649840
Nedd1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NEDD1 mRNA	CTD	PMID:25729387
Nedd1	Rat	ozone	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NEDD1 mRNA more ...	CTD	PMID:32699268
Nedd1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of NEDD1 mRNA	CTD	PMID:33387578
Nedd1	Rat	potassium chromate	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NEDD1 mRNA	CTD	PMID:22079256
Nedd1	Rat	potassium chromate	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of NEDD1 mRNA	CTD	PMID:22079256
Nedd1	Rat	quercetin	increases phosphorylation	ISO	NEDD1 (Homo sapiens)	6480464	Quercetin results in increased phosphorylation of NEDD1 protein	CTD	PMID:35688186
Nedd1	Rat	resveratrol	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of NEDD1 mRNA	CTD	PMID:23557933
Nedd1	Rat	sodium arsenite	decreases expression	ISO	NEDD1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of NEDD1 mRNA	CTD	PMID:38568856
Nedd1	Rat	tamoxifen	affects expression	ISO	Nedd1 (Mus musculus)	6480464	Tamoxifen affects the expression of NEDD1 mRNA	CTD	PMID:17555576
Nedd1	Rat	tetrachloroethene	increases expression	ISO	Nedd1 (Mus musculus)	6480464	Tetrachloroethylene results in increased expression of NEDD1 mRNA	CTD	PMID:28973375
Nedd1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of NEDD1 mRNA	CTD	PMID:34492290
Nedd1	Rat	titanium dioxide	increases methylation	ISO	Nedd1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of NEDD1 promoter	CTD	PMID:35295148
Nedd1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NEDD1 mRNA	CTD	PMID:25729387
Nedd1	Rat	triphenyl phosphate	affects expression	ISO	NEDD1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of NEDD1 mRNA	CTD	PMID:37042841
Nedd1	Rat	triptonide	decreases expression	ISO	Nedd1 (Mus musculus)	6480464	triptonide results in decreased expression of NEDD1 mRNA	CTD	PMID:33045310
Nedd1	Rat	valproic acid	decreases methylation	ISO	NEDD1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of NEDD1 gene	CTD	PMID:29154799
Nedd1	Rat	valproic acid	multiple interactions	ISO	NEDD1 (Homo sapiens)	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of NEDD1 mRNA	CTD	PMID:17183730
Nedd1	Rat	vorinostat	increases expression	ISO	NEDD1 (Homo sapiens)	6480464	vorinostat results in increased expression of NEDD1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nedd1	Rat	microtubule nucleation	involved_in	IBA	FB:FBgn0032705 and PANTHER:PTN001871829	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	mitotic cell cycle	involved_in	IBA	FB:FBgn0032705 and PANTHER:PTN001871829	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nedd1	Rat	apical part of cell	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	centriole	is_active_in	IBA	MGI:97293 and PANTHER:PTN001871829	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	centriole	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	centrosome	is_active_in	IBA	MGI:97293 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	centrosome	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	centrosome	located_in	ISO	NEDD1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Nedd1	Rat	centrosome	located_in	ISO	NEDD1 (Homo sapiens)	1624291	PMID:21399614 and PMID:27137183	RGD	PMID:21399614 and PMID:27137183
Nedd1	Rat	ciliary basal body	is_active_in	IBA	MGI:97293 and PANTHER:PTN001871829	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	ciliary basal body	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0032705 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	cytoplasm	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	cytosol	located_in	ISO	NEDD1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Nedd1	Rat	fibrillar center	located_in	ISO	NEDD1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Nedd1	Rat	nucleoplasm	located_in	ISO	NEDD1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Nedd1	Rat	pericentriolar material	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929
Nedd1	Rat	spindle pole	is_active_in	IBA	FB:FBgn0032705 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	spindle pole	located_in	ISO	Nedd1 (Mus musculus)	1624291	PMID:18239929	RGD	PMID:18239929

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nedd1	Rat	gamma-tubulin binding	enables	IBA	FB:FBgn0032705 and PANTHER:PTN001871829	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nedd1	Rat	protein binding	enables	ISO	NEDD1 (Homo sapiens)	1624291	UniProtKB:P0DMV8 more ...	RGD	PMID:19369198 and PMID:27137183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18239929	PMID:21399614	PMID:27137183

Nedd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	29,120,200 - 29,161,634 (-)	NCBI		GRCr8
mRatBN7.2	7	27,233,050 - 27,274,486 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	27,233,316 - 27,274,486 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	29,227,389 - 29,268,826 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	31,389,742 - 31,431,181 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	31,157,130 - 31,202,370 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	33,544,097 - 33,584,406 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	33,543,828 - 33,584,564 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	33,615,235 - 33,655,544 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	29,704,249 - 29,745,416 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	29,724,518 - 29,773,468 (-)	NCBI
Celera	7	24,340,948 - 24,381,914 (-)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

NEDD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	96,907,257 - 96,953,780 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	96,907,224 - 96,953,780 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	97,301,035 - 97,347,558 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	95,825,375 - 95,870,172 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	95,803,711 - 95,848,507	NCBI
Celera	12	96,967,004 - 97,013,462 (+)	NCBI		Celera
Cytogenetic Map	12	q23.1	NCBI
HuRef	12	94,363,760 - 94,410,169 (+)	NCBI		HuRef
CHM1_1	12	97,265,952 - 97,312,431 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	96,881,012 - 96,927,469 (+)	NCBI		T2T-CHM13v2.0

Nedd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	92,520,607 - 92,559,544 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	92,520,608 - 92,558,282 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	92,684,745 - 92,722,418 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	92,684,746 - 92,722,420 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	92,147,490 - 92,185,163 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	92,114,545 - 92,152,159 (-)	NCBI		MGSCv36	mm8
Celera	10	94,676,340 - 94,714,125 (-)	NCBI		Celera
Cytogenetic Map	10	C2	NCBI
cM Map	10	47.25	NCBI

Nedd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	33,058,839 - 33,112,358 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	33,066,734 - 33,109,750 (+)	NCBI	ChiLan1.0	ChiLan1.0

NEDD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	104,979,049 - 105,056,810 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	104,975,439 - 105,053,206 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	94,497,203 - 94,543,412 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	97,914,112 - 97,959,953 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	97,914,112 - 97,959,945 (+)	Ensembl	panpan1.1		panPan2

NEDD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	36,542,218 - 36,589,380 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	36,542,152 - 36,587,758 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	36,926,673 - 36,973,707 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	37,206,756 - 37,253,864 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	37,205,935 - 37,253,850 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	36,478,601 - 36,525,635 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	36,572,344 - 36,619,417 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	36,843,539 - 36,890,793 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101957471
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	52,940,558 - 52,946,286 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936677	2,954,738 - 2,963,072 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEDD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	86,693,843 - 86,737,222 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	86,693,802 - 86,737,259 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	91,290,874 - 91,316,139 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NEDD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	92,256,975 - 92,301,430 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	92,259,578 - 92,301,605 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	152,798,574 - 152,843,034 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nedd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	10,498,365 - 10,541,081 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	10,497,362 - 10,542,732 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Nedd1
633 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	453
Count of miRNA genes:	248
Interacting mature miRNAs:	305
Transcripts:	ENSRNOT00000005463
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	20555705	29891047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
61369	Mcs2	Mammary carcinoma susceptibility QTL 2	3.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	19032807	35526300	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat

RH143697

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	27,234,709 - 27,234,827 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	33,545,491 - 33,545,608	NCBI	Rnor6.0
Rnor_5.0	7	33,616,629 - 33,616,746	UniSTS	Rnor5.0
RGSC_v3.4	7	29,705,643 - 29,705,760	UniSTS	RGSC3.4
Celera	7	24,342,342 - 24,342,459	UniSTS
RH 3.4 Map	7	179.9	UniSTS
Cytogenetic Map	7	q13	UniSTS

BE095746

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	27,240,087 - 27,240,238 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	33,550,869 - 33,551,019	NCBI	Rnor6.0
Rnor_5.0	7	33,622,007 - 33,622,157	UniSTS	Rnor5.0
RGSC_v3.4	7	29,711,021 - 29,711,171	UniSTS	RGSC3.4
Celera	7	24,347,519 - 24,347,669	UniSTS
RH 3.4 Map	7	181.3	UniSTS
Cytogenetic Map	7	q13	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT415945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005463 ⟹ ENSRNOP00000005463

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	27,233,316 - 27,274,486 (-)	Ensembl
Rnor_6.0 Ensembl	7	33,543,828 - 33,584,564 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105705 ⟹ ENSRNOP00000088691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	27,233,316 - 27,274,486 (-)	Ensembl

RefSeq Acc Id:

NM_001106779 ⟹ NP_001100249

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	29,120,200 - 29,161,634 (-)	NCBI
mRatBN7.2	7	27,233,050 - 27,274,486 (-)	NCBI
Rnor_6.0	7	33,544,097 - 33,584,406 (-)	NCBI
Rnor_5.0	7	33,615,235 - 33,655,544 (-)	NCBI
RGSC_v3.4	7	29,704,249 - 29,745,416 (-)	RGD
Celera	7	24,340,948 - 24,381,914 (-)	RGD

Sequence:

show sequence

GTGGAGCCGGGCCCCCCTGTGGTCCCACGCTTGAGAGGCTCAGCCATGCAGGAAAACCTCAGATTTGCCTCATCAGGAGATGATGTTAAAATATGGGATGCTTCGTTTCTGACATTGGTGGATAAATT
CAACCCCCACACGTCACCGCATGGAATCAGTTCAATCTGTTGGAGCAGCAATAATAACTTCCTAGTGACTGCGTCTTCTGGTGGTGACAAAATAGTGGTGTCAAGTTGCAAATGTAAGCCCGTTCCAC
TTTTGGAGCTTGCGGAAGGGCAAAAGCAGACATGTGTCGATTTAAATTCTACATCAATGTATTTGGCAAGTGGAGGCCTAAATAACACTGTTAATATTTGGGATTTAAAGTCAAAACGACTTCATCGG
TCTCTTAAGGACCATAAACGGGAAGTAACTTGTGTGGCGTACAATTGGAATGATTGTTACATTGCTTCCGGGTCTCTCAGTGGTGAGATTATCTTACACAGCGTAACCACTAATACCTCCAGTACGCC
TTTCGGCCATGGGAGTAAGCAGCCTGTCCGGCACATCAAGTACTCGTTGTTTAGGAAGTCTCTCTTGGGCAGCGTTTCGGATAATGGAGTAGTGACCCTCTGGGATGTGAACAGTCAGAGTGCATACC
ACAGCTTTGACAGTACACACAAAGCCCCAGCTTCAGGCCTCTGCTTCTCTCCTGTCAACGAACTGCTGTTTGTGACCATAGGCCTGGATAAAAGAATCATCCTGTATGACACTTCAAGTAAGAAGCTG
GTGAAAACTTTAGTGGCTGACACTCCTCTGACTGCTGTAGATTTTATGCCAGATGGAGCCAGTTTGGCTATTGGATCCTCCCGTGGGAAAATATATCAGTATGACTTAAGGATGCTGAAATCTCCCGT
GAAAACCATCAGCGCCCACAAGACATCTGTGCAGTGTATAGCATTTCAGTACTCCACATCTCTGACGAAGGCAAGTTTAAATAAAGGCTGCTCAAATAAGGCCACAGCAGCGAACAAACGGAGTGTTC
CTGTGGGCAGCAGCAGTGGGGCTGCCCAGAATTCTGGAATTGTCAGAGAAGCACCCAGCCCTTCCATTGCCACAGTTCTCCCACAGCCCGTGACGACAGCTGTGGGCAAAGGAGCAGGGGCTGCTCAG
GACGAAGCAGGTTTGCCTCGAAGCAAAAATACAGATATCTTATCTAAGGAAACTGATGCTGGAAAAAGTCAAGACTTCTCCAGCTTTGATGACACGGGGAAGAGTAGTTTAGGGGACATGTTTTCACC
AATTAGAGATGATGCTGTAGTCAACAAAGGAGGTGACGAGTCTGTAGGCAAAGGAGATGGCCTTGACTTTCTACCACAGCTAAACTCGGTGTTCCCCCTGAGGAAGAATGCAGGCTCCTCCAGCACTC
TGGTGCTGCACTCCAGCCCTTTTAATGTCCTTATGGGGACAGGGAAGGAAGAGCATGAGAGTCACGAGCTGTCAGCCGAGTCTAAGAAGGCACACCTTGGGAAGCCGGAGCCTAAGGACTCCTTGAAG
CAGTTTACAAAGTTGATCTCCTCTGGTGCTGAACCTGGAATTCTAAACACCTGTCCATCATCTAACCAAGCAAGAAATCTTGAAAAGTTTGAAAAGCCAGAAAAAGATATTGAAGTCCAGTTGATGCA
CGAACCCTCAGTCAATGGATCCTCAACTCCAGTACCAAAGGCAGCCTCCTCCGTCACTGCTGGAGTAGCCAGTTCACTCTCAGAAAAAATAGTCGACACCCTTGGGAACAGTCGGCCGGCCGCGCCAC
TTACCTCTGTCCAGATCCGCTTCATTCAGAACATGATACAAGAAACCCTGGATGACTTCAGGGAAGCTTGCCATAGGGACATTGTGAATCTGCAAGTGGAAATGATTAAACAGTTTCATATGCAACTG
AATGAAATGCACTCTTTGCTGGAAAGATACTCAGTGAATGAAGGCTTAGTGGCTGAGATCGAAAGGCTGCGAGAAGAAAACAAAAGGCTGCGGGCCCACTTCTGAAGCCTCTGGACACCTTGATTTGT
TATGAGTTAGGTTTCTGGCAACTGAAATACACAGAACCAGTATTGTTCGCATGGCCTTGAAAACGGATTCTGCAGCGCGCACTATTCCATCTCTGTCAGACATATTATATTTTTATATTAAAACTGCA
CGGAATACCATCTTCCTAGTGGGGAAGTCAACAGGATCTTTATTTTCTGATCGCCTTAGCTATACACTAAGTGCCCTTTTCCTAAAAGAAAAAAAAATGTTCATATAAGAATGGGTTTATGTTTTGTA
AATGACTTTTTAAAACAGATATATTTTTGATGGACAAATTGTATTCCAAATTTTTTTAGGTAGCCAATGTTTAAAACCCTGGTATACCTTCTATTTTATAAAGAAATAATTTTAAAGTGGCAATTGGA
TTTTTTCACAGTTTCGTAATTATTTTGTTAACATGACGACATCAGGTATGACTTATTTATTTAGTATATATGTAATACATTTTGTGTTGTACAGATACATGGTAACTTTGTTCTGGTTACCTAACTTT
ATATAGGAAAAACTTTTAAGAGTTTGGAAGATTCAAGGGCTATGTATATCTGCTGATTGTCTAATGAATTAACGAAATGCAAAATCATACTCTCAGATTTTCATTACCATGACTCAACTTAGGATCAG
TGAAATTTTCTTATAAGATACTAAATATTACATATTGTTGCCATTTTTTTCCTCACAACTGAAAGGGATAGATTATTTCTTCTGTGTTGTTTACCATTAACTTTTTCTAATTACAATGTGCTGTGAAC
AGCACTTTCTCTCTTTAGCCTTACCATAATATTATTTATAAAGATTCATCATGCAAAGAATTTACACGTTGGCAGCACTGACCATGTTCCTCTGCCTGCTGTGACCCACACTTTGATGGTGTTGGATG
CCTCTTGCCCAAAGATTTCATCTGTGTACTTTATACAGAGATCTGCTACCCACTTTTGCTTTCCAGGATCAAGATGTTTACTAAAATGTAGCTTAGATTACTAACTGGGTTTCTAAAGAGGTGGAAGC
TGTTAGGGTGTATTTAATAAATATAAACTTATGAATAATTATCTCCAAAAGTGGATCAGGAGCAGGACTTTTCCCAAGCTTCTCAGAAAGTCTATTTGTGTATCAAGTGTCCGTGGCCTTTACTTAGC
AGATATGGTGACACTATGACTTGTAACAAGTCCCCTTATATGTCACTCAAACAATGTTAGAATGCAGAAGTCCTTTGTCTATATACTACATTTTAATCTATTAATATTTTCCTACTTCTTTTTTCTAT
AGGTGTATATATTGTGTATTAAGGGGGATCTGATAGAACATGTGTATAGGTGAACACTTGTCATGGATTTAAGCACTGAGGACAATAAATTTTGTATTCAAAATGT

hide sequence

RefSeq Acc Id:

XM_039078693 ⟹ XP_038934621

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	29,120,200 - 29,161,601 (-)	NCBI
mRatBN7.2	7	27,233,315 - 27,274,482 (-)	NCBI


Protein RefSeqs	NP_001100249	(Get FASTA)	NCBI Sequence Viewer
	XP_038934621	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM16930	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005463
	ENSRNOP00000005463.4
	ENSRNOP00000088691.1
GenBank Protein	QWM97822	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001100249 ⟸ NM_001106779

- UniProtKB:

D3ZAH3 (UniProtKB/TrEMBL), A6IFW8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQENLRFASSGDDVKIWDASFLTLVDKFNPHTSPHGISSICWSSNNNFLVTASSGGDKIVVSSCKCKPVPLLELAEGQKQTCVDLNSTSMYLASGGLNNTVNIWDLKSKRLHRSLKDHKREVTCVAYN
WNDCYIASGSLSGEIILHSVTTNTSSTPFGHGSKQPVRHIKYSLFRKSLLGSVSDNGVVTLWDVNSQSAYHSFDSTHKAPASGLCFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDF
MPDGASLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTSLTKASLNKGCSNKATAANKRSVPVGSSSGAAQNSGIVREAPSPSIATVLPQPVTTAVGKGAGAAQDEAGLPRSKNTDILS
KETDAGKSQDFSSFDDTGKSSLGDMFSPIRDDAVVNKGGDESVGKGDGLDFLPQLNSVFPLRKNAGSSSTLVLHSSPFNVLMGTGKEEHESHELSAESKKAHLGKPEPKDSLKQFTKLISSGAEPGIL
NTCPSSNQARNLEKFEKPEKDIEVQLMHEPSVNGSSTPVPKAASSVTAGVASSLSEKIVDTLGNSRPAAPLTSVQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEG
LVAEIERLREENKRLRAHF

hide sequence

Ensembl Acc Id:

ENSRNOP00000005463 ⟸ ENSRNOT00000005463

RefSeq Acc Id:	XP_038934621 ⟸ XM_039078693
- Peptide Label:	isoform X1
- UniProtKB:	D3ZAH3 (UniProtKB/TrEMBL), A6IFW8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088691 ⟸ ENSRNOT00000105705

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZAH3-F1-model_v2	AlphaFold	D3ZAH3	1-659	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34429	BioCyc
Ensembl Genes	ENSRNOG00000004011	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005463	ENTREZGENE
	ENSRNOT00000005463.7	UniProtKB/TrEMBL
	ENSRNOT00000105705.1	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
InterPro	NEDD1_Spindle_Assembly	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:299730	UniProtKB/TrEMBL
NCBI Gene	299730	ENTREZGENE
PANTHER	PROTEIN NEDD1	UniProtKB/TrEMBL
	PROTEIN NEDD1	UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/TrEMBL
PhenoGen	Nedd1	PhenoGen
PROSITE	WD_REPEATS_1	UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004011	RatGTEx
SMART	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	WD40_like	UniProtKB/TrEMBL
UniProt	A0A8I6A9Z2_RAT	UniProtKB/TrEMBL
	A6IFW8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZAH3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-08	Nedd1	NEDD1 gamma-tubulin ring complex targeting factor	Nedd1	neural precursor cell expressed, developmentally down-regulated 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Nedd1	neural precursor cell expressed, developmentally down-regulated 1	Nedd1	neural precursor cell expressed, developmentally down-regulated gene 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Nedd1	neural precursor cell expressed, developmentally down-regulated gene 1	Nedd1_predicted	neural precursor cell expressed, developmentally down-regulated gene 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Nedd1_predicted	neural precursor cell expressed, developmentally down-regulated gene 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message