Advanced Search (OLGA)

Gene: Ccbe1 (collagen and calcium binding EGF domains 1) Rattus norvegicus

Analyze

Symbol:

Ccbe1

Name:

collagen and calcium binding EGF domains 1

RGD ID:

1307670

Description:

Predicted to enable collagen binding activity and protease binding activity. Predicted to be involved in several processes, including positive regulation of gene expression; positive regulation of lymphangiogenesis; and positive regulation of vascular endothelial growth factor signaling pathway. Predicted to act upstream of or within several processes, including lymphangiogenesis; positive regulation of endothelial cell migration; and respiratory system process. Predicted to be located in extracellular matrix and extracellular space. Human ortholog(s) of this gene implicated in Hennekam syndrome. Orthologous to human CCBE1 (collagen and calcium binding EGF domains 1); INTERACTS WITH bisphenol A; gentamycin; paracetamol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

collagen and calcium-binding EGF domain-containing protein 1; LOC361341; RGD1307670; similar to MEGF6 (4P83)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,849,821 - 62,093,876 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	61,853,149 - 62,094,075 (-)	Ensembl				GRCr8
mRatBN7.2	18	59,579,851 - 59,823,977 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,580,768 - 59,824,400 (-)	Ensembl				mRatBN7.2
Rnor_6.0	18	61,758,754 - 62,013,194 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,759,289 - 61,788,863 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	60,953,314 - 61,204,084 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	62,407,265 - 62,442,194 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	57,703,958 - 57,944,773 (-)	NCBI		Celera
RGSC_v3.1	18	62,444,950 - 62,516,306 (+)	NCBI
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Distal Renal Tubular Acidosis 4 with Hemolytic Anemia (ISO)

Facies (ISO)

genetic disease (ISO)

Hennekam Lymphangiectasia-Lymphedema Syndrome 1 (ISO)

Hennekam syndrome (ISO)

hepatocellular carcinoma (ISO)

Hydrops Fetalis (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-Nitrobenzanthrone (ISO)

4,4'-sulfonyldiphenol (ISO)

4-nonylphenol (ISO)

4-tert-Octylphenol (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chloroprene (ISO)

chrysene (ISO)

cisplatin (ISO)

crocidolite asbestos (ISO)

DDE (ISO)

Didecyldimethylammonium (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

maleic acid (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monoethyl phthalate (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

p-chloromercuribenzoic acid (ISO)

p-tert-Amylphenol (ISO)

paracetamol (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

propanal (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

lung development (ISO)

lymph vessel development (ISO)

lymphangiogenesis (IEA,ISO)

positive regulation of angiogenesis (IEA,ISO)

positive regulation of endothelial cell migration (ISO)

positive regulation of lymphangiogenesis (IEA,ISO)

positive regulation of protein processing (IEA,ISO)

positive regulation of vascular endothelial growth factor production (IEA,ISO)

positive regulation of vascular endothelial growth factor signaling pathway (IEA,ISO)

respiratory gaseous exchange by respiratory system (ISO)

respiratory system process (ISO)

Cellular Component

extracellular matrix (IEA,ISO)

extracellular space (IEA,ISO)

Molecular Function

calcium ion binding (IEA)

collagen binding (IEA,ISO)

protease binding (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19935664	PMID:21778431	PMID:24552833	PMID:24733830

Genomics

Comparative Map Data

Ccbe1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,849,821 - 62,093,876 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	61,853,149 - 62,094,075 (-)	Ensembl				GRCr8
mRatBN7.2	18	59,579,851 - 59,823,977 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,580,768 - 59,824,400 (-)	Ensembl				mRatBN7.2
Rnor_6.0	18	61,758,754 - 62,013,194 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,759,289 - 61,788,863 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	60,953,314 - 61,204,084 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	62,407,265 - 62,442,194 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	57,703,958 - 57,944,773 (-)	NCBI		Celera
RGSC_v3.1	18	62,444,950 - 62,516,306 (+)	NCBI
Cytogenetic Map	18	q12.1	NCBI

CCBE1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	59,430,939 - 59,697,721 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	59,430,939 - 59,697,694 (-)	Ensembl			hg38	GRCh38
GRCh37	18	57,098,171 - 57,364,655 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	55,252,124 - 55,515,570 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	55,252,128 - 55,515,570	NCBI
Celera	18	53,815,992 - 54,082,692 (-)	NCBI		Celera
Cytogenetic Map	18	q21.32	NCBI
HuRef	18	53,807,272 - 54,074,065 (-)	NCBI		HuRef
CHM1_1	18	57,093,481 - 57,360,274 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	59,632,718 - 59,900,788 (-)	NCBI		T2T-CHM13v2.0

Ccbe1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	66,189,926 - 66,424,909 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	66,178,373 - 66,435,812 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	66,056,855 - 66,291,838 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	66,045,302 - 66,302,741 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	66,216,510 - 66,451,492 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	66,186,267 - 66,417,201 (-)	NCBI		MGSCv36	mm8
Celera	18	67,332,660 - 67,571,414 (-)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.13	NCBI

Ccbe1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	43,555,924 - 43,819,706 (-)	Ensembl
ChiLan1.0	NW_004955402	43,551,810 - 43,819,731 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCBE1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	76,925,872 - 77,237,725 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	62,662,702 - 62,930,251 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	52,819,591 - 53,087,772 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	56,149,036 - 56,412,550 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	56,149,036 - 56,412,222 (-)	Ensembl			panPan2	panpan1.1

CCBE1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	16,597,389 - 16,819,888 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	16,597,334 - 16,819,894 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	17,573,095 - 17,795,588 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	16,468,211 - 16,697,179 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	16,468,224 - 16,697,173 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	16,503,987 - 16,732,917 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	16,430,870 - 16,653,326 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	16,686,056 - 16,915,078 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccbe1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	30,049,305 - 30,083,693 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936497	5,290,077 - 5,321,876 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936497	5,290,068 - 5,321,656 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCBE1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	161,321,273 - 161,556,537 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	161,320,627 - 161,556,539 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	178,904,622 - 179,130,264 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCBE1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	20,054,281 - 20,363,024 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	20,271,874 - 20,309,784 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666060	5,250,942 - 5,540,578 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccbe1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624792	4,867,858 - 5,146,839 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624792	4,863,978 - 5,146,907 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccbe1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	65,145,212 - 65,208,975 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccbe1
1278 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	97
Interacting mature miRNAs:	104
Transcripts:	ENSRNOT00000034069, ENSRNOT00000034075
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	53350521	68120379	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	53845175	61982387	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	49187226	62647720	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61982204	76619168	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61600384	72538878	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	54490801	68120379	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	52198059	68120379	Rat

Markers in Region

D18Mit8

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	59,796,478 - 59,796,643 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,985,648 - 61,985,812	NCBI	Rnor6.0
Rnor_5.0	18	61,176,840 - 61,177,004	UniSTS	Rnor5.0
RGSC_v3.4	18	62,228,896 - 62,229,060	UniSTS	RGSC3.4
Celera	18	57,917,062 - 57,917,198	UniSTS
RGSC_v3.1	18	62,301,978 - 62,302,324	RGD
RH 3.4 Map	18	604.6	RGD
RH 3.4 Map	18	604.6	UniSTS
RH 2.0 Map	18	307.7	RGD
SHRSP x BN Map	18	32.1699	RGD
Cytogenetic Map	18	q12.1	UniSTS

D18Mgh2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	61,982,204 - 61,982,387 (+)	Marker Load Pipeline
mRatBN7.2	18	59,712,234 - 59,712,417 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,901,172 - 61,901,354	NCBI	Rnor6.0
Rnor_5.0	18	61,092,364 - 61,092,546	UniSTS	Rnor5.0
RGSC_v3.4	18	62,313,112 - 62,313,296	RGD	RGSC3.4
RGSC_v3.4	18	62,313,114 - 62,313,296	UniSTS	RGSC3.4
Celera	18	57,832,923 - 57,833,105	UniSTS
RGSC_v3.1	18	62,386,313 - 62,386,497	RGD
RH 3.4 Map	18	602.5	UniSTS
RH 3.4 Map	18	602.5	RGD
RH 2.0 Map	18	310.1	RGD
Cytogenetic Map	18	q12.1	UniSTS

D18Wox16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	61,965,155 - 61,965,335 (+)	Marker Load Pipeline
mRatBN7.2	18	59,695,184 - 59,695,364 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,884,069 - 61,884,248	NCBI	Rnor6.0
Rnor_5.0	18	61,075,400 - 61,075,579	UniSTS	Rnor5.0
RGSC_v3.4	18	62,330,217 - 62,330,398	RGD	RGSC3.4
RGSC_v3.4	18	62,330,218 - 62,330,397	UniSTS	RGSC3.4
Celera	18	57,815,916 - 57,816,095	UniSTS
RGSC_v3.1	18	62,403,418 - 62,403,599	RGD
RH 3.4 Map	18	602.4	RGD
RH 3.4 Map	18	602.4	UniSTS
RH 2.0 Map	18	310.8	RGD
Cytogenetic Map	18	q12.1	UniSTS

AU048444

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	59,625,062 - 59,625,247 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,813,930 - 61,814,114	NCBI	Rnor6.0
Rnor_5.0	18	61,005,667 - 61,005,851	UniSTS	Rnor5.0
RGSC_v3.4	18	62,401,071 - 62,401,255	UniSTS	RGSC3.4
Celera	18	57,744,890 - 57,745,066	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

MHAa74a6.seq

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	59,781,575 - 59,781,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,970,746 - 61,970,895	NCBI	Rnor6.0
Rnor_5.0	18	61,161,938 - 61,162,087	UniSTS	Rnor5.0
RGSC_v3.4	18	62,243,812 - 62,243,961	UniSTS	RGSC3.4
Celera	18	57,902,138 - 57,902,287	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

RH144242

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	59,825,274 - 59,825,453 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,013,684 - 62,013,862	NCBI	Rnor6.0
Rnor_5.0	18	61,204,876 - 61,205,054	UniSTS	Rnor5.0
RGSC_v3.4	18	62,733,436 - 62,733,614	UniSTS	RGSC3.4
Celera	18	57,945,268 - 57,945,446	UniSTS
RH 3.4 Map	18	605.6	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

AI709546

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	59,583,773 - 59,583,922 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	61,758,883 - 61,759,031	NCBI	Rnor6.0
Rnor_5.0	18	60,953,443 - 60,953,591	UniSTS	Rnor5.0
RGSC_v3.4	18	62,443,042 - 62,443,190	UniSTS	RGSC3.4
Celera	18	57,704,087 - 57,704,235	UniSTS
RH 3.4 Map	18	595.3	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

AFMa341xb5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	18	62,432,444 - 62,433,353	UniSTS	RGSC3.4
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	145	91	90	59	30	59	6	291	130	11	120	78	92	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001432454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017587883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034069 ⟹ ENSRNOP00000031817

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	61,759,289 - 61,788,863 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000034075 ⟹ ENSRNOP00000038619

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	61,762,103 - 61,788,859 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116155 ⟹ ENSRNOP00000094341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	61,853,149 - 62,094,075 (-)	Ensembl
mRatBN7.2 Ensembl	18	59,580,768 - 59,824,400 (-)	Ensembl

RefSeq Acc Id:

XM_017601124 ⟹ XP_017456613

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	61,849,821 - 62,093,876 (-)	NCBI
mRatBN7.2	18	59,579,851 - 59,823,977 (-)	NCBI
Rnor_6.0	18	61,758,754 - 62,013,194 (-)	NCBI

Sequence:

show sequence

CTCTGCATGTGTGTGAGTGCTTCTTCCCTTGTCACAGCGATCGCTGTGCCTGAGACTCTTCCTG
ACTTGTTCGTCCTTTAACTGGCTGTGAAAAGGAACCCCCTACTAGGTACCAGTTAGGTACAGGC
ACCTGGGTTCAAAACCCTCAGCTGGGAATTTCTCACTTGTCCTGAACTGCAGTTACCAAGAAAA
TCGCGGCACAAAGGGTTGTGGACGAGTGAAACGACCTAATTTCCTCTAAAAGGGAACGAAGATT
CTACACTTTCCTGATTGGGTTATGTCACGTTTGGAAGGGCGATACAGGAGACCCCCTCTAACCG
CTGCTCACCCTTTCATATTCTAAGCGAGAACCCGGACAGAGGAAAAGCACTTGCGAGCGAAAAG
GCAAACATTGGCTTGACCCTTCGCTGTGGAAGTTAACTGACAACAGGAAGGAAGCTATTAACCC
CGCTCCTCTCCTCCTCTCGCCCTGGTGACAGCCAGCAACTCCTCCTCCCAGGCTGAGACCTTGG
AATAAAAATGCAAAGGAGCGCCTGGCTGCCTCAACTCCGCGCTTCTCTCCCAGGGGTGGAAGAG
AGGAGGGCGCAGCCTGAAGCCAAGTTCAGCCTGTTTGTTACTCGAATCTGATTGTCCAGAAGAG
ATTTCCCGGGACTCCGGCATCCTCCCTCTGGCCGCGCAAGGCAGACACCCCTTTGACAAGCTTG
GTTCACCCCCTCTCACCCCAAGTTTGAAGGGGGCCCGCAGGTGGTGCAAGCGCCCCAGCTCTCC
GGCGCCCTCTGCTGGCGAGAGGGGAAGGCGGCTGCGGCCGCGGAGCCTCCCCGGGCACAGCGCA
GGGAGAGAGCTCGGGTGCCGAGAAGAAGCCGGCGAGCTTCCCCGATGGTGCCGCCGCTTCCTCT
GAGCCGGGGAGGAGCAGTCAAGGGGCAGCTGGGCAAGAGCCTGGGGCCGCTGCTGCTACTCCTG
GCGCTGGGACACACGTGGACCTTCCGAGAGGAACCCGAGGACCGAGACAGAGAAGTGTGCTCGG
AAAACAAGATCACCACGACCAAATACCCGTGTCTGAAGTCTTCAGGCGAGCTCACCACGTGCTT
CAGGAAAAAATGCTGCAAAGGATATAAATTTGTCCTTGGACAGTGTATTCCAGAAGATTATGAC
ATTTGTGCCCAAGCTCCCTGTGAACAGCAATGCACGGATAACTTCGGCCGTGTGCTGTGCACGT
GCTATCCAGGATACCGATATGACCGAGAGAGGCACCAAAAGCGGGAGAAGCCATACTGCCTGGA
TATCGATGAGTGTGCCACCGGCAACACCACTCTGTGTGCACATACCTGCGTCAACACCATGGGC
AGCTACCACTGTGAGTGTCGGGAGGGCTACATCCTTGAGGACGATGGGAGGACCTGCACGAGGG
GAGACAAATACCCCAATGACACTGGGCATGAGGAGAAGTCCGAGAATGAGGTGAAAGCTGGGAC
CTGCTGTGCCACATGCAAGGAGTTCTCCCAGATGAAGCAGACGGTGCTGCAGCTGAAGCAGAAG
ATTTCTCTGCTCCCCAACAATGCCGCCGAACTGGGCAAGTATGTCAATGGTGACAAGGTGCTGG
CCTCGAACACCTATCTTCCAGGACCTCCTGGCCTGCCTGGGGGACAGGGCCCACCTGGCTCACC
AGGACCCAAGGGGAGCCCTGGATTCCCCGGTATGCCAGGCCCTCCTGGACAACCAGGCCCACGG
GGCTCAATGGGACCTATGGGACCATCCCCTGACCTGTCTCATATTAAGCAAGGCCGGAGGGGCC
CTGTGGGTCCACCAGGAGCACCAGGAAGACATGGCTTGAAGGGGGAGAGAGGAGCACCTGGGCC
CCCAGGGTCTCCGGGACCCCCAGGTTCTTTTGACTTCCTGCTGCTGGTACTGGCGGACATTCGA
AATGATATCGCAGAGCTACAGGAGAAAGTGTTTGGACATCGGATTCACTCTTCTGCAGAGGACT
TCCCCCTACCTCAGGAATTCTCCAGCTACCCAGAGACCCTGGACTTTGGGTCTGGAGATGACTA
TTCCAGAAGAACTGAAGCAAGGGACTCTGAGGCCCCGAGAAACTTTTATCCATAGCACATCCCA
TATCTTCAAGCCACCAGAAGAGAAGCTTGCCTTCGTCCTTCCCCTTACTCGGTTTCCAAACCCT
GCCTTCTAAGTTTCCTTCGCATCACAACAGCAGCAGGAGGATGTGATGGGTTGACATGCTGTTC
TTGAAGAGCCAATGGGTGGTTAACATCAAGGCTTTCTTTAGCATCCTACTTTTTCAAGAACCTT
TGGAATTCTGAGTTAATCGCTCCCACCGAATCTTAAACGTTGGTAGAGTGCAAGAGAGGGAGAA
ATGGCAACATGGGTTCTTAGAAGTGTAAGGTTCCTTCTAAAAAGAAAATGATGTTCAAGTACTT
GACTGTTCATTCTCTACTGTCCAGAGTAAGGCTTTTCAGTTGTGGAGGAATGGGGTGTGGAAGG
AGCAACCACGTAAAATGACATTGGTGGAAAATTACTTTTCTTATCAATGTCACAGATTTCAAAT
TCTGCATCCTATTTTTCAGCTTGATGTTTGTTTGTTTGTTTTTAAATTTGCTTACAAAAAACAA
GAAATTGGAAAGAA

hide sequence

RefSeq Acc Id:

XM_039097364 ⟹ XP_038953292

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	61,854,281 - 62,093,876 (-)	NCBI
mRatBN7.2	18	59,584,307 - 59,823,977 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001419383	(Get FASTA)	NCBI Sequence Viewer
	XP_017456613	(Get FASTA)	NCBI Sequence Viewer
	XP_038953292	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14707	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000094341
	ENSRNOP00000094341.1

RefSeq Acc Id:

XP_017456613 ⟸ XM_017601124

- Peptide Label:

isoform X1

- Sequence:

show sequence

MVPPLPLSRGGAVKGQLGKSLGPLLLLLALGHTWTFREEPEDRDREVCSENKITTTKYPCLKSS
GELTTCFRKKCCKGYKFVLGQCIPEDYDICAQAPCEQQCTDNFGRVLCTCYPGYRYDRERHQKR
EKPYCLDIDECATGNTTLCAHTCVNTMGSYHCECREGYILEDDGRTCTRGDKYPNDTGHEEKSE
NEVKAGTCCATCKEFSQMKQTVLQLKQKISLLPNNAAELGKYVNGDKVLASNTYLPGPPGLPGG
QGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRHGLKG
ERGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRIHSSAEDFPLPQEFSSYPETLD
FGSGDDYSRRTEARDSEAPRNFYP

hide sequence

Ensembl Acc Id:

ENSRNOP00000031817 ⟸ ENSRNOT00000034069

Ensembl Acc Id:

ENSRNOP00000038619 ⟸ ENSRNOT00000034075

RefSeq Acc Id:	XP_038953292 ⟸ XM_039097364
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000094341 ⟸ ENSRNOT00000116155

Protein Domains

EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LV50-F1-model_v2	AlphaFold	F1LV50	1-319	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307670	AgrOrtholog
BioCyc Gene	G2FUF-7196	BioCyc
Ensembl Genes	ENSRNOG00000024536	Ensembl
	ENSRNOG00000062986	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000116155	ENTREZGENE
	ENSRNOT00000116155.2	UniProtKB/TrEMBL
Gene3D-CATH	Laminin	UniProtKB/TrEMBL
InterPro	Collagen	UniProtKB/TrEMBL
	EGF-like_Ca-bd_dom	UniProtKB/TrEMBL
	EGF-like_dom	UniProtKB/TrEMBL
	EGF-type_Asp/Asn_hydroxyl_site	UniProtKB/TrEMBL
	EGF_Ca-bd_CS	UniProtKB/TrEMBL
	Nephronectin_domain	UniProtKB/TrEMBL
	NOTCH1_EGF-like	UniProtKB/TrEMBL
KEGG Report	rno:361341	UniProtKB/TrEMBL
NCBI Gene	361341	ENTREZGENE
PANTHER	COLLAGEN	UniProtKB/TrEMBL
	COLLAGEN AND CALCIUM BINDING EGF DOMAINS 1	UniProtKB/TrEMBL
	PA14 DOMAIN-CONTAINING PROTEIN	UniProtKB/TrEMBL
	UROMODULIN-LIKE	UniProtKB/TrEMBL
Pfam	Collagen	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
PhenoGen	Ccbe1	PhenoGen
PROSITE	ASX_HYDROXYL	UniProtKB/TrEMBL
	EGF_2	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024536	RatGTEx
	ENSRNOG00000062986	RatGTEx
SMART	EGF	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/TrEMBL
UniProt	A0A8I6AR48	ENTREZGENE, UniProtKB/TrEMBL
	A6IXS6	ENTREZGENE, UniProtKB/TrEMBL
	A6IXS7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-02	Ccbe1	collagen and calcium binding EGF domains 1	Ccbe1	collagen and calcium binding EGF domains 1	Data merged from RGD:149736243	737654	PROVISIONAL
2021-08-09	Ccbe1	collagen and calcium binding EGF domains 1			Symbol and Name status set to provisional	45752	PROVISIONAL
2008-04-30	Ccbe1	collagen and calcium binding EGF domains 1	Ccbe1_predicted	collagen and calcium binding EGF domains 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Ccbe1_predicted	collagen and calcium binding EGF domains 1 (predicted)	RGD1307670_predicted	similar to MEGF6 (4P83) (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1307670_predicted	similar to MEGF6 (4P83) (predicted)	LOC361341_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361341_predicted	similar to MEGF6 (4P83) (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM