Advanced Search (OLGA)

Gene: Cblc (Cbl proto-oncogene C) Rattus norvegicus

Analyze

Symbol:

Cblc

Name:

Cbl proto-oncogene C

RGD ID:

1307651

Description:

Predicted to enable several functions, including SH3 domain binding activity; phosphotyrosine residue binding activity; and signaling receptor binding activity. Predicted to be involved in several processes, including negative regulation of signal transduction; protein ubiquitination; and ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within several processes, including negative regulation of neuron apoptotic process; protein stabilization; and response to glial cell derived neurotrophic factor. Predicted to be active in membrane raft and plasma membrane. Orthologous to human CBLC (Cbl proto-oncogene C); PARTICIPATES IN chronic myeloid leukemia pathway; endocytosis pathway; epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 1-nitropropane; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Cas-Br-M (murine) ecotropic retroviral transforming sequence c; Casitas B-lineage lymphoma C; Cbl proto-oncogene C, E3 ubiquitin protein ligase; Cbl proto-oncogene, E3 ubiquitin protein ligase C; E3 ubiquitin-protein ligase CBL-C; LOC292699; MGC124804; RING-type E3 ubiquitin transferase CBL-C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CBLC (Cbl proto-oncogene C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cblc (Cbl proto-oncogene c)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cblc (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CBLC (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CBLC (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cblc (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CBLC (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CBLC (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cblc (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cblc (Cbl proto-oncogene C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DNASE1 (deoxyribonuclease 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CBLC (Cbl proto-oncogene C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cblc (Cbl proto-oncogene c)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cblc (Cbl proto-oncogene C, E3 ubiquitin protein ligase)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Cbl	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	sli-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	sli-1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cblc	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,567,930 - 88,584,709 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	88,567,932 - 88,584,709 (-)	Ensembl				GRCr8
mRatBN7.2	1	79,439,975 - 79,456,755 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,439,977 - 79,456,755 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	84,834,432 - 84,851,213 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,385,937 - 93,402,717 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,589,544 - 86,606,331 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,699,321 - 80,716,146 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,699,323 - 80,716,146 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,964,679 - 81,981,515 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,091,412 - 79,108,189 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	73,898,303 - 73,914,949 (-)	NCBI		Celera
RGSC_v3.1	1	79,170,940 - 79,186,278 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropropane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-diaminotoluene (EXP)

2,6-diaminotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-nitro-p-phenylenediamine (EXP)

2-nitropropane (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-acetylaminofluorene (EXP)

4-nitro-1,2-phenylenediamine (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

copper(II) chloride (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

folic acid (ISO)

furan (EXP)

glycidol (EXP)

inulin (ISO)

irinotecan (EXP)

methapyrilene (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

orphenadrine (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

PCB138 (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

progesterone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

testosterone (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP)

Triptolide (EXP)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface receptor signaling pathway (IEA)

negative regulation of epidermal growth factor receptor signaling pathway (IBA,IEA,ISO)

negative regulation of MAPK cascade (IEA,ISO)

negative regulation of neuron apoptotic process (ISO)

protein catabolic process (ISO)

protein stabilization (ISO)

protein ubiquitination (IEA,ISO)

regulation of signaling (IEA)

response to glial cell derived neurotrophic factor (ISO)

signal transduction (IBA)

ubiquitin-dependent protein catabolic process (IEA,ISO)

Cellular Component

membrane raft (IBA)

plasma membrane (IBA)

Molecular Function

calcium ion binding (IEA)

epidermal growth factor receptor binding (IEA,ISO)

metal ion binding (IEA)

phosphotyrosine residue binding (IEA,ISO)

protein binding (ISO)

receptor tyrosine kinase binding (IBA)

SH3 domain binding (IEA,ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IBA,IEA,ISO)

ubiquitin-protein transferase activity (IEA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

chronic myeloid leukemia pathway (IEA)

endocytosis pathway (IEA)

epidermal growth factor/neuregulin signaling pathway (IEA)

insulin signaling pathway (IEA)

Jak-Stat signaling pathway (IEA)

T cell receptor signaling pathway (IEA)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10362357	PMID:12477932	PMID:14661060	PMID:23376485

Genomics

Comparative Map Data

Cblc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,567,930 - 88,584,709 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	88,567,932 - 88,584,709 (-)	Ensembl				GRCr8
mRatBN7.2	1	79,439,975 - 79,456,755 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,439,977 - 79,456,755 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	84,834,432 - 84,851,213 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,385,937 - 93,402,717 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,589,544 - 86,606,331 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,699,321 - 80,716,146 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,699,323 - 80,716,146 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,964,679 - 81,981,515 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,091,412 - 79,108,189 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	73,898,303 - 73,914,949 (-)	NCBI		Celera
RGSC_v3.1	1	79,170,940 - 79,186,278 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

CBLC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	44,777,869 - 44,800,652 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	44,777,845 - 44,802,291 (+)	Ensembl			hg38	GRCh38
GRCh37	19	45,281,126 - 45,303,909 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	49,972,988 - 49,995,731 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	49,972,987 - 49,995,731	NCBI
Celera	19	42,085,488 - 42,107,328 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	41,713,154 - 41,735,790 (+)	NCBI		HuRef
CHM1_1	19	45,283,856 - 45,306,632 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	47,602,623 - 47,625,402 (+)	NCBI		T2T-CHM13v2.0

Cblc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	19,513,643 - 19,530,734 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	19,512,806 - 19,530,734 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	19,779,718 - 19,796,809 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,778,881 - 19,796,809 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	20,365,067 - 20,382,158 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,938,242 - 18,955,331 (-)	NCBI		MGSCv36	mm8
Celera	7	17,187,514 - 17,204,632 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.94	NCBI

Cblc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	1,921,912 - 1,935,096 (+)	Ensembl
ChiLan1.0	NW_004955555	1,921,896 - 1,941,247 (+)	NCBI	ChiLan1.0	ChiLan1.0

CBLC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	50,933,383 - 50,960,455 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	52,808,296 - 52,832,395 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	41,726,272 - 41,748,829 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	50,331,257 - 50,353,865 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

CBLC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	110,590,548 - 110,606,775 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	110,590,804 - 110,606,781 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	110,071,648 - 110,088,645 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	111,153,520 - 111,169,844 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	111,153,776 - 111,169,908 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	110,794,862 - 110,811,626 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	110,430,583 - 110,447,333 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	111,299,843 - 111,316,680 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cblc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,089,393 - 17,106,072 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936706	1,436,732 - 1,450,485 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CBLC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	51,276,544 - 51,292,549 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	51,274,717 - 51,292,546 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	47,174,865 - 47,192,017 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CBLC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	38,257,418 - 38,285,534 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	38,257,672 - 38,280,051 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	17,821,913 - 17,852,623 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cblc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	1,676,021 - 1,691,137 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624907	1,676,296 - 1,690,479 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cblc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	170,819,082 - 170,834,454 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cblc
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	62
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000025829
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat

Markers in Region

D1Rat261

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	88,577,808 - 88,577,965 (+)	Marker Load Pipeline
mRatBN7.2	1	79,449,854 - 79,450,011 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,709,251 - 80,709,404	NCBI	Rnor6.0
Rnor_5.0	1	81,974,609 - 81,974,762	UniSTS	Rnor5.0
RGSC_v3.4	1	79,101,290 - 79,101,447	RGD	RGSC3.4
RGSC_v3.4	1	79,101,291 - 79,101,447	UniSTS	RGSC3.4
RGSC_v3.1	1	79,179,402 - 79,179,558	RGD
RH 3.4 Map	1	787.1	UniSTS
RH 3.4 Map	1	787.1	RGD
RH 2.0 Map	1	512.2	RGD
SHRSP x BN Map	1	41.1399	RGD
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	48	52	90	90	59	21	59	6	256	92	1	33	81	91	31	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN934498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025829 ⟹ ENSRNOP00000025829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	88,567,932 - 88,584,709 (-)	Ensembl
mRatBN7.2 Ensembl	1	79,439,977 - 79,456,755 (-)	Ensembl
Rnor_6.0 Ensembl	1	80,699,323 - 80,716,146 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092048 ⟹ ENSRNOP00000070090

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	88,571,463 - 88,584,709 (-)	Ensembl
mRatBN7.2 Ensembl	1	79,443,496 - 79,456,755 (-)	Ensembl
Rnor_6.0 Ensembl	1	80,700,479 - 80,716,143 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110504 ⟹ ENSRNOP00000095345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	88,567,932 - 88,584,709 (-)	Ensembl
mRatBN7.2 Ensembl	1	79,439,977 - 79,456,755 (-)	Ensembl

RefSeq Acc Id:

NM_001034920 ⟹ NP_001030092

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	88,567,930 - 88,584,709 (-)	NCBI
mRatBN7.2	1	79,439,975 - 79,456,755 (-)	NCBI
Rnor_6.0	1	80,699,321 - 80,716,146 (-)	NCBI
Rnor_5.0	1	81,964,679 - 81,981,515 (-)	NCBI
RGSC_v3.4	1	79,091,412 - 79,108,189 (-)	RGD
Celera	1	73,898,303 - 73,914,949 (-)	RGD

Sequence:

show sequence

TCCCAGGCCACCCGAGCGACCCATGGCTGCGGCTACAGCCCCGCAAGGGTGGCAGTGGGGAGAG
CCACGCGCGCTTGGCCGGGCGGTAAAGTTGCTCCAGCGCCTGGAAGAGCAATGCAGGGATCTCA
GGCTGTTCGTGGGGCCCCCGTCGCTACGGGACCTGCTACCCCGCACCGCACAGCTACTTCGAGA
GGTGGCAAAAGCCCGGAGCGATAAGACCAGGGGAGACCCCGAGGGTCCCGGAGGCGCCGGTGAT
TTTCTGGTTATCTACCTGACCAACCTGGAGGCCAAAGGCAGGCAGGTGGCTGAGCTCCTGCCAC
ACCGCGGCAAAAAGGACGCGAACCAGGATGTTTTCCCGGAGGGCTCCAGATTCAGGCGACAACT
GGCCAAGCTGGCTCTCATCTTCAGTCACATGCATGCGGAGTTGAGCGCACTCTTCCCTGAGGGC
AAGTACTGTGGGCACCTGTACCAGATCACCAAGGGCTCTGCCAACACCTTCTGGAGGGAGAATT
GTGGAGTTCGGTGCGTCCTTCCCTGGGCTGAGTTCCAGTCCCTCCTGTGCTCCTGCCACCCTGT
GGAACCAGGCCCCATCATGCAGGCCTTGCGGTCCACCTTGGACCTCACCTGTAGCGGCCACGTG
TCTGTCTTTGAGTTCGACATCTTCACCAGGCTCTTCCAGCCGTGGCCCACTTTACTGAAGAATT
GGCAACTCCTGGCTGTCAACCATCCTGGCTACATGGCCTTCCTCACCTACGATGAGGTCCAAAC
ACGTCTGCAGGCCTACAGGGACAAACCGGGCAGCTATATCTTCCGGCCCAGCTGTACCCGCCTA
GGGCAGTGGGCCATTGGGTACGTGAGCTCCAATGGAAGCATCCTACAGACCATTCCTCTCAACA
AGCCTCTGCTCCAGGTGCTCCTGAAAGGACAAAAGGACGGCATCTTCCTCTACCCTGATGGAAA
GAACCACAACCCAGACTTGACTGAGCTCTGCCGTGCAGAACTGAACCAGTGCATCCAAGTGTCA
CAGGAACAACTGCAGCTCTACCAAGCCATGAACTCCACCTTTGAGCTGTGCAAGATCTGCACAG
AGAGGGACAAGGACGTGAGAATTGAGCCCTGTGGGCATCTTCTCTGCAGCTGCTGCCTGGCTGC
CTGGCAGCACTCAGACAGCCAGACCTGTCCCTTCTGCCGCTGTGAGATCAAAGGCCGAGAGGCT
GTGAGTATCTGTCAGGCACAGGAGAGGTCAATGGAGGTCAGGACTACTGCAGGTGACTCAGGAG
ACAACTGTCACCAGGAGGCTGCCGAATGGAAACTGGAATCGGTGACTCCTTCTGCTCCCCCACT
GCCCCCTGAAGTTCCATGCCCTCAGAGACCCCAAGACAAAGGCTGGCTGACACTGGCACCGTTC
ACCCTGCCCAGACTCCGACCTCCACTTCCTCTCCCCAAAATGGCATCAGTTCTGTGGGAAGTCA
CCTCCAGGCCCCAGGTCAGGGAGGGGGCCACAGAAAGCTCCTGAAAAGGGAAAGCACCCTCCAG
GTGGCCCTGCGAGACCCTCGGTTCTGCCCAAAACCCAGAGGCCAGGGCACCTGGACTGGAGGAA
GGGAGCCTTGGAGCTGGAAGGGGTGACAAAGCCGAAATAAATTAATCCTGATCTTTCAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001030092	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05777	(Get FASTA)	NCBI Sequence Viewer
	EDM08130	(Get FASTA)	NCBI Sequence Viewer
	EDM08131	(Get FASTA)	NCBI Sequence Viewer
	EDM08132	(Get FASTA)	NCBI Sequence Viewer
	EDM08133	(Get FASTA)	NCBI Sequence Viewer
	EDM08134	(Get FASTA)	NCBI Sequence Viewer
	EDM08135	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025829
	ENSRNOP00000025829.4
GenBank Protein	G3V8H4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001030092 ⟸ NM_001034920

- UniProtKB:

Q3KRC9 (UniProtKB/Swiss-Prot), G3V8H4 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAAATAPQGWQWGEPRALGRAVKLLQRLEEQCRDLRLFVGPPSLRDLLPRTAQLLREVAKARSD
KTRGDPEGPGGAGDFLVIYLTNLEAKGRQVAELLPHRGKKDANQDVFPEGSRFRRQLAKLALIF
SHMHAELSALFPEGKYCGHLYQITKGSANTFWRENCGVRCVLPWAEFQSLLCSCHPVEPGPIMQ
ALRSTLDLTCSGHVSVFEFDIFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQTRLQAYRD
KPGSYIFRPSCTRLGQWAIGYVSSNGSILQTIPLNKPLLQVLLKGQKDGIFLYPDGKNHNPDLT
ELCRAELNQCIQVSQEQLQLYQAMNSTFELCKICTERDKDVRIEPCGHLLCSCCLAAWQHSDSQ
TCPFCRCEIKGREAVSICQAQERSMEVRTTAGDSGDNCHQEAAEWKLESVTPSAPPLPPEVPCP
QRPQDKGWLTLAPFTLPRLRPPLPLPKMASVLWEVTSRPQVREGATESS

hide sequence

Ensembl Acc Id:

ENSRNOP00000070090 ⟸ ENSRNOT00000092048

Ensembl Acc Id:

ENSRNOP00000025829 ⟸ ENSRNOT00000025829

Ensembl Acc Id:

ENSRNOP00000095345 ⟸ ENSRNOT00000110504

Protein Domains

Cbl-PTB RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8H4-F1-model_v2	AlphaFold	G3V8H4	1-497	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689783

Promoter ID:

EPDNEW_R308

Type:

multiple initiation site

Name:

Cblc_1

Description:

Cbl proto-oncogene C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	80,716,142 - 80,716,202	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307651	AgrOrtholog
BioCyc Gene	G2FUF-60484	BioCyc
Ensembl Genes	ENSRNOG00000018953	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025829	ENTREZGENE
	ENSRNOT00000025829.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.930.20	UniProtKB/Swiss-Prot
	3.30.40.10	UniProtKB/Swiss-Prot
	3.30.505.10	UniProtKB/Swiss-Prot
	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7931977	IMAGE-MGC_LOAD
InterPro	Adaptor_Cbl	UniProtKB/Swiss-Prot
	Adaptor_Cbl_EF_hand-like	UniProtKB/Swiss-Prot
	Adaptor_Cbl_N_dom_sf	UniProtKB/Swiss-Prot
	Adaptor_Cbl_N_hlx	UniProtKB/Swiss-Prot
	Adaptor_Cbl_SH2-like	UniProtKB/Swiss-Prot
	Cbl_PTB	UniProtKB/Swiss-Prot
	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	SH2_dom_sf	UniProtKB/Swiss-Prot
	Znf_RING	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
	Znf_RING_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:292699	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124804	IMAGE-MGC_LOAD
NCBI Gene	292699	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE CBL-C	UniProtKB/Swiss-Prot
	PTHR23007	UniProtKB/Swiss-Prot
Pfam	Cbl_N	UniProtKB/Swiss-Prot
	Cbl_N2	UniProtKB/Swiss-Prot
	Cbl_N3	UniProtKB/Swiss-Prot
	zf-C3HC4_3	UniProtKB/Swiss-Prot
PhenoGen	Cblc	PhenoGen
PROSITE	CBL_PTB	UniProtKB/Swiss-Prot
	ZF_RING_1	UniProtKB/Swiss-Prot
	ZF_RING_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018953	RatGTEx
SMART	RING	UniProtKB/Swiss-Prot
Superfamily-SCOP	RING/U-box	UniProtKB/Swiss-Prot
	SSF47473	UniProtKB/Swiss-Prot
	SSF47668	UniProtKB/Swiss-Prot
	SSF55550	UniProtKB/Swiss-Prot
UniProt	A0A8I6AL90_RAT	UniProtKB/TrEMBL
	A0A8L2R3L5_RAT	UniProtKB/TrEMBL
	A6J8U9_RAT	UniProtKB/TrEMBL
	A6J8V0_RAT	UniProtKB/TrEMBL
	A6J8V2_RAT	UniProtKB/TrEMBL
	A6J8V3_RAT	UniProtKB/TrEMBL
	A6J8V4_RAT	UniProtKB/TrEMBL
	CBLC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3KRC9	ENTREZGENE
UniProt Secondary	Q3KRC9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-05	Cblc	Cbl proto-oncogene C	Cblc	Casitas B-lineage lymphoma C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-05-04	Cblc	Casitas B-lineage lymphoma C	Cblc	Cbl proto-oncogene C, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-07-18	Cblc	Cbl proto-oncogene C, E3 ubiquitin protein ligase	Cblc	Cbl proto-oncogene, E3 ubiquitin protein ligase C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-13	Cblc	Cbl proto-oncogene, E3 ubiquitin protein ligase C	Cblc	Cas-Br-M (murine) ecotropic retroviral transforming sequence c	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Cblc	Cas-Br-M (murine) ecotropic retroviral transforming sequence c	Cblc	Casitas B-lineage lymphoma c	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cblc	Casitas B-lineage lymphoma c	Cblc_predicted	Casitas B-lineage lymphoma c (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cblc_predicted	Casitas B-lineage lymphoma c (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)